MTA1 Antibody (4D11)

Images

 
Western Blot: MTA1 Antibody (4D11) [H00009112-M02] - MTA1 monoclonal antibody (M02), clone 4D11 Analysis of MTA1 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: MTA1 Antibody (4D11) [H00009112-M02] - Analysis of monoclonal antibody to MTA1 on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: MTA1 Antibody (4D11) [H00009112-M02] - MTA1 monoclonal antibody (M02), clone 4D11. Analysis of MTA1 expression in PC-12.
Western Blot: MTA1 Antibody (4D11) [H00009112-M02] - MTA1 monoclonal antibody (M02), clone 4D11. Analysis of MTA1 expression in NIH/3T3.
Sandwich ELISA: MTA1 Antibody (4D11) [H00009112-M02] - Detection limit for recombinant GST tagged MTA1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MTA1 Antibody (4D11) Summary

Immunogen
MTA1 (NP_004680, 601 a.a. ~ 700 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSRGLANHGQTRHMGPSRNLLLNGKSYPTKVRLIRGGSLPPVKRRRMNWIDAPDDVFYMATEETRKIRKLLSSSETKRAARRPYKPIALRQSQALPPRP
Specificity
MTA1 - metastasis associated 1
Isotype
IgG3 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MTA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MTA1 Antibody (4D11)

  • metastasis associated 1
  • metastasis associated gene 1 protein
  • metastasis associated protein
  • metastasis-associated protein MTA1

Background

This gene encodes a protein that was identified in a screen for genes expressed in metastatic cells, specifically, mammary adenocarcinoma cell lines. Expression of this gene has been correlated with the metastatic potential of at least two types of carcinomas although it is also expressed in many normal tissues. The role it plays in metastasis is unclear. It was initially thought to be the 70kD component of a nucleosome remodeling deacetylase complex, NuRD, but it is more likely that this component is a different but very similar protein. These two proteins are so closely related, though, that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. The profile and activity of this gene product suggest that it is involved in regulating transcription and that this may be accomplished by chromatin remodeling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTA1 Antibody (H00009112-M02) (0)

There are no publications for MTA1 Antibody (H00009112-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTA1 Antibody (H00009112-M02) (0)

There are no reviews for MTA1 Antibody (H00009112-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTA1 Antibody (H00009112-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTA1 Products

Research Areas for MTA1 Antibody (H00009112-M02)

Find related products by research area.

Blogs on MTA1

There are no specific blogs for MTA1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTA1 Antibody (4D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol MTA1
Entrez
OMIM
Uniprot