MTA3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MTA3 Antibody [NBP1-82919] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: MTA3 Antibody [NBP1-82919] - Staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MTA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MPTQSEEEKLSPSPTTEDPRVRSHVSRQAMQGMPVRNTGSPKSAVKTRQA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MTA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MTA3 Protein (NBP1-82919PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MTA3 Antibody

  • member 3
  • metastasis associated 1 family, member 3
  • metastasis-associated protein MTA3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-260
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-56483
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-57521
Species: Hu, Mu
Applications: WB, IP
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB600-235
Species: Hu, Mu, Po
Applications: WB, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB120-3535
Species: Hu, Mu, Fi
Applications: WB, ICC/IF, IHC
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, PLA
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
NB100-56534
Species: Hu
Applications: WB, IHC-P, ICC
NB200-331
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82919
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MTA3 Antibody (NBP1-82919) (0)

There are no publications for MTA3 Antibody (NBP1-82919).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTA3 Antibody (NBP1-82919) (0)

There are no reviews for MTA3 Antibody (NBP1-82919). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MTA3 Antibody (NBP1-82919) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTA3 Products

Bioinformatics Tool for MTA3 Antibody (NBP1-82919)

Discover related pathways, diseases and genes to MTA3 Antibody (NBP1-82919). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MTA3 Antibody (NBP1-82919)

Discover more about diseases related to MTA3 Antibody (NBP1-82919).
 

Pathways for MTA3 Antibody (NBP1-82919)

View related products by pathway.

PTMs for MTA3 Antibody (NBP1-82919)

Learn more about PTMs related to MTA3 Antibody (NBP1-82919).
 

Research Areas for MTA3 Antibody (NBP1-82919)

Find related products by research area.

Blogs on MTA3

There are no specific blogs for MTA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MTA3