MRPS30 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: FAWTGAQAMYQGFWSEADVTRPFVSQAVITDGKYFSFFCYQLNTLALTTQADQNNPRKNICWGTQSKPLYETIEDNDVKGFNDDVLLQIVHFLLNRP |
| Predicted Species |
Mouse (91%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPS30 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MRPS30 Antibody - BSA Free
Background
MRPS30, or Mitochondrial Ribosomal Protein S30, consists of a 439 amino acid isoform that is 50 kDa, and is involved in mitochondrial protein synthesis in the heart, skeletal muscles, kidney, and liver. Current disease research is being conducted on MRPS30 and its relation to breast cancer, neuronitis, and prostatitis. MRPS30 has been linked to translation and apoptosis, through which it interacts with ICT1, MAGEA11, AARS2, AASS, and ABCB7.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: ELISA
Species: Hu, Rt, Mu
Applications: WB, IHC
Publications for MRPS30 Antibody (NBP1-87343) (0)
There are no publications for MRPS30 Antibody (NBP1-87343).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPS30 Antibody (NBP1-87343) (0)
There are no reviews for MRPS30 Antibody (NBP1-87343).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPS30 Antibody (NBP1-87343) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPS30 Products
Research Areas for MRPS30 Antibody (NBP1-87343)
Find related products by research area.
|
Blogs on MRPS30