MRPS11 Antibody Summary
Immunogen |
MRPS11 (NP_073750.2, 1 a.a. - 194 a.a.) full-length human protein. MQAVRNAGSRFLRSWTWPQTAGRVVARTPAGTICTGARQLQDAAAKQKVEQNAAPSHTKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLAFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGRLSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL |
Specificity |
MRPS11 - mitochondrial ribosomal protein S11, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
MRPS11 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for MRPS11 Antibody
Background
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that contains a high level of sequence similarity with ribosomal protein S11P family members. A pseudogene corresponding to this gene is found on chromosome 20. Sequence analysis identified two transcript variants that encode different protein isoforms. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
Species: Mu
Applications: BA
Species: Hu
Applications: BA, BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Mu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB
Publications for MRPS11 Antibody (H00064963-B02P) (0)
There are no publications for MRPS11 Antibody (H00064963-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPS11 Antibody (H00064963-B02P) (0)
There are no reviews for MRPS11 Antibody (H00064963-B02P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPS11 Antibody (H00064963-B02P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPS11 Products
Bioinformatics Tool for MRPS11 Antibody (H00064963-B02P)
Discover related pathways, diseases and genes to MRPS11 Antibody (H00064963-B02P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MRPS11 Antibody (H00064963-B02P)
Discover more about diseases related to MRPS11 Antibody (H00064963-B02P).
| | Pathways for MRPS11 Antibody (H00064963-B02P)
View related products by pathway.
|
Blogs on MRPS11