MRPL51 Antibody

Images

 
Western Blot: MRPL51 Antibody [NBP1-88567] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MRPL51 Antibody [NBP1-88567] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL51 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL51
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL51 Protein (NBP1-88567PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL51 Antibody

  • bMRP64bMRP-64
  • HSPC241,39S ribosomal protein L51, mitochondrial
  • L51mt
  • mitochondrial ribosomal protein 64
  • mitochondrial ribosomal protein bMRP64
  • mitochondrial ribosomal protein L51
  • MRP64CDA09
  • MRP-L51

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34951
Species: Hu
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-63269
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IP
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84725
Species: Hu
Applications: WB, IHC, IHC-P
AF1120
Species: Mu
Applications: WB, IHC
NBP1-83882
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13618
Species: Hu
Applications: IHC, IHC-P
NB100-1919
Species: Hu, Mu, Rt, Ca, Fe
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-30482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065008-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7895
Species: Hu
Applications: WB, IHC
AF1334
Species: Hu
Applications: WB, IHC
NBP1-88567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MRPL51 Antibody (NBP1-88567) (0)

There are no publications for MRPL51 Antibody (NBP1-88567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL51 Antibody (NBP1-88567) (0)

There are no reviews for MRPL51 Antibody (NBP1-88567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPL51 Antibody (NBP1-88567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL51 Products

Bioinformatics Tool for MRPL51 Antibody (NBP1-88567)

Discover related pathways, diseases and genes to MRPL51 Antibody (NBP1-88567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL51 Antibody (NBP1-88567)

Discover more about diseases related to MRPL51 Antibody (NBP1-88567).
 

Pathways for MRPL51 Antibody (NBP1-88567)

View related products by pathway.

Blogs on MRPL51

There are no specific blogs for MRPL51, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL51 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL51