MRPL51 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MRPL51 Antibody [NBP1-88567] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.

Immunohistochemistry-Paraffin: MRPL51 Antibody [NBP1-88567] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp

• Reactivity: Hu
• Applications: WB, Flow, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRPL51 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRPL51 Antibody - BSA Free (NBP1-88567) is a polyclonal antibody validated for use in IHC, WB, Flow and ICC/IF. Anti-MRPL51 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MRPL51
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Flow Cytometry
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockdown Validated
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100. Use in KD, WB, Flow reported in scientifc publication ( PMID: 32618081).
• Control Peptide:

  MRPL51 Protein (NBP1-88567PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MRPL51 Antibody - BSA Free

• bMRP64bMRP-64
• HSPC241,39S ribosomal protein L51, mitochondrial
• L51mt
• mitochondrial ribosomal protein 64
• mitochondrial ribosomal protein bMRP64
• mitochondrial ribosomal protein L51
• MRP64CDA09
• MRP-L51

Background

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within themitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. Theyhave an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed.Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA.Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes inbiochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.Pseudogenes corresponding to this gene are found on chromosomes 4p and 21q. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MRPL51 Antibody (NBP1-88567)(1)

Publication using NBP1-88567

• Guan X, Zhang H, Qin H et al. CRISPR/Cas9-mediated whole genomic wide knockout screening identifies mitochondrial ribosomal proteins involving in oxygen-glucose deprivation/reperfusion resistance J. Cell. Mol. Med. 2020-07-02 [PMID: 32618081] (WB, FLOW, KD, Human)

Bioinformatics

• Gene Symbol: MRPL51