SMEK2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SMEK2 Antibody [NBP1-83882] - Staining of human cell line U-251 MG shows localization to nucleoplasm & centrosome. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Analysis in human fallopian tube and skeletal muscle tissues using NBP1-83882 antibody. Corresponding PPP4R38 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human fallopian tube shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human cerebral cortex shows weak to moderate nuclear positivity in neurons.

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human testis shows moderate to strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line HDLM-2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SMEK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SMEK2 Antibody - BSA Free (NBP1-83882) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SMEK2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SMEK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SMEK2 Protein (NBP1-83882PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SMEK2 Antibody - BSA Free

• FLFL2
• FLJ31474
• KIAA1387serine/threonine-protein phosphatase 4 regulatory subunit 3B
• PP4R3B
• PPP4R3B
• PSY2
• SMEK homolog 2
• SMEK homolog 2, suppressor of mek1 (Dictyostelium)
• smk1

Background

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C atcentrosomal microtubule organizing centers

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SMEK2 Antibody (NBP1-83882)(1)

Publication using NBP1-83882

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: SMEK2