SMEK2 Antibody

Images

 
Western Blot: SMEK2 Antibody [NBP1-83882] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
Western Blot: SMEK2 Antibody [NBP1-83882] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-21Lane 4: Human cell line A-431
Immunofluorescence: SMEK2 Antibody [NBP1-83882] - Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Product Details

Summary
Reactivity Hu, Mu, Rt, MouseSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit

Order Details

SMEK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMEK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
SMEK2 Protein (NBP1-83882PEP)
Publications
Read Publication using NBP1-83882.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Alternate Names for SMEK2 Antibody

  • FLFL2
  • FLJ31474
  • KIAA1387serine/threonine-protein phosphatase 4 regulatory subunit 3B
  • PP4R3B
  • PPP4R3B
  • PSY2
  • SMEK homolog 2
  • SMEK homolog 2, suppressor of mek1 (Dictyostelium)
  • smk1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5074
Species: Hu
Applications: WB
MAB1626
Species: Hu
Applications: WB, ICC
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002027-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NB100-581
Species: Hu
Applications: WB, IP, PLA
NB100-56340
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB100-2879
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-54436
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP

Publications for SMEK2 Antibody (NBP1-83882)(1)

Reviews for SMEK2 Antibody (NBP1-83882) (0)

There are no reviews for SMEK2 Antibody (NBP1-83882). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMEK2 Antibody (NBP1-83882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SMEK2 Antibody Products

Related Products by Gene

Bioinformatics Tool for SMEK2 Antibody (NBP1-83882)

Discover related pathways, diseases and genes to SMEK2 Antibody (NBP1-83882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMEK2 Antibody (NBP1-83882)

Discover more about diseases related to SMEK2 Antibody (NBP1-83882).
 

Pathways for SMEK2 Antibody (NBP1-83882)

View related products by pathway.

PTMs for SMEK2 Antibody (NBP1-83882)

Learn more about PTMs related to SMEK2 Antibody (NBP1-83882).

Blogs on SMEK2

There are no specific blogs for SMEK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol SMEK2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-83882 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought