SMEK2 Antibody


Western Blot: SMEK2 Antibody [NBP1-83882] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: SMEK2 Antibody [NBP1-83882] - Staining of human cerebral cortex shows moderate nuclear positivity in neuronal cells.
Western Blot: SMEK2 Antibody [NBP1-83882] - Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line EFO-21. Lane 4: Human cell line A-431
Immunofluorescence: SMEK2 Antibody [NBP1-83882] - Staining of human cell line U-2 OS shows positivity in nucleus but not nucleoli.

Product Details

Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF

Order Details

SMEK2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:GQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVMPPLE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
SMEK2 Protein (NBP1-83882PEP)
Read Publication using NBP1-83882.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Alternate Names for SMEK2 Antibody

  • FLFL2
  • FLJ31474
  • KIAA1387serine/threonine-protein phosphatase 4 regulatory subunit 3B
  • PP4R3B
  • PPP4R3B
  • PSY2
  • SMEK homolog 2
  • SMEK homolog 2, suppressor of mek1 (Dictyostelium)
  • smk1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Ce
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, IP, PLA
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ca
Applications: IP (-), WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IP

Publications for SMEK2 Antibody (NBP1-83882)(1)

Reviews for SMEK2 Antibody (NBP1-83882) (0)

There are no reviews for SMEK2 Antibody (NBP1-83882). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SMEK2 Antibody (NBP1-83882) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SMEK2 Antibody Products

Related Products by Gene

Bioinformatics Tool for SMEK2 Antibody (NBP1-83882)

Discover related pathways, diseases and genes to SMEK2 Antibody (NBP1-83882). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMEK2 Antibody (NBP1-83882)

Discover more about diseases related to SMEK2 Antibody (NBP1-83882).

Pathways for SMEK2 Antibody (NBP1-83882)

View related products by pathway.

PTMs for SMEK2 Antibody (NBP1-83882)

Learn more about PTMs related to SMEK2 Antibody (NBP1-83882).

Blogs on SMEK2

There are no specific blogs for SMEK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our SMEK2 Antibody and receive a gift card or discount.


Gene Symbol SMEK2

Customers Who Bought This Also Bought