MRPL22 Antibody

Images

 
Western Blot: MRPL22 Antibody [NBP2-30482] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MRPL22 Antibody [NBP2-30482] - Immunofluorescent staining of human cell line MCF7 shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL22 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: IKEVLLQAQDMAVRDHNVEFRSNLYIAESTSGRGQCLKRIRYHGRGRFGIMEKVYCHYFVKLVEGPPPPPEPPKTAVAHAKEYIQQLRSRTIVHTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:250 - 1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL22 Protein (NBP2-30482PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL22 Antibody

  • 39S ribosomal protein L25, mitochondrial
  • DKFZp781F1071
  • L22mt
  • L25mt
  • mitochondrial ribosomal protein L22
  • MRP-L22
  • MRPL25
  • MRP-L25HSPC158
  • RPML2539S ribosomal protein L22, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008847-P01
Species: Hu
NBP2-60949
Species: AB, Bv, Gt, Sh, WB
Applications: Flow, Func, IHC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-88567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87847
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81685
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
26660002
Species: Hu
Applications: ELISA, IHC, IHC-P
NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83651
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82786
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13623
Species: Hu
Applications: IHC, IHC-P
NBP2-33587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065008-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF

Publications for MRPL22 Antibody (NBP2-30482) (0)

There are no publications for MRPL22 Antibody (NBP2-30482).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL22 Antibody (NBP2-30482) (0)

There are no reviews for MRPL22 Antibody (NBP2-30482). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPL22 Antibody (NBP2-30482) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL22 Products

Bioinformatics Tool for MRPL22 Antibody (NBP2-30482)

Discover related pathways, diseases and genes to MRPL22 Antibody (NBP2-30482). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MRPL22 Antibody (NBP2-30482)

View related products by pathway.

Blogs on MRPL22

There are no specific blogs for MRPL22, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL22
Uniprot