MRPS35 Antibody


Western Blot: MRPS35 Antibody [NBP1-82786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MRPS35 Antibody [NBP1-82786] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining in human kidney and pancreas tissues using anti-MRPS35 antibody. Corresponding MRPS35 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MRPS35 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK
Specificity of human, human (negative) MRPS35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS35 Protein (NBP1-82786PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPS35 Antibody

  • 28S ribosomal protein S28, mitochondrial
  • DKFZp762P093
  • MDS023,28S ribosomal protein S35, mitochondrial
  • MGC104278
  • mitochondrial ribosomal protein S28
  • mitochondrial ribosomal protein S35
  • MRP-S28
  • MRPS28S35mt
  • MRP-S35
  • S28mt


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for MRPS35 Antibody (NBP1-82786) (0)

There are no publications for MRPS35 Antibody (NBP1-82786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS35 Antibody (NBP1-82786) (0)

There are no reviews for MRPS35 Antibody (NBP1-82786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS35 Antibody (NBP1-82786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPS35 Products

Bioinformatics Tool for MRPS35 Antibody (NBP1-82786)

Discover related pathways, diseases and genes to MRPS35 Antibody (NBP1-82786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS35 Antibody (NBP1-82786)

Discover more about diseases related to MRPS35 Antibody (NBP1-82786).

Pathways for MRPS35 Antibody (NBP1-82786)

View related products by pathway.

Blogs on MRPS35

There are no specific blogs for MRPS35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPS35 Antibody and receive a gift card or discount.


Gene Symbol MRPS35