MRPS35 Antibody

Images

 
Western Blot: MRPS35 Antibody [NBP1-82786] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MRPS35 Antibody [NBP1-82786] - Staining of human cell line A-431 shows localization to cytosol & mitochondria.
Immunohistochemistry-Paraffin: MRPS35 Antibody [NBP1-82786] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPS35 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPS35
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS35 Protein (NBP1-82786PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPS35 Antibody

  • 28S ribosomal protein S28, mitochondrial
  • DKFZp762P093
  • MDS023,28S ribosomal protein S35, mitochondrial
  • MGC104278
  • mitochondrial ribosomal protein S28
  • mitochondrial ribosomal protein S35
  • MRP-S28
  • MRPS28S35mt
  • MRP-S35
  • S28mt

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-33717
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53421
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-07799
Species: Hu
NBP1-87006
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NB100-1939
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
H00001040-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-30482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00065008-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7385
Species: Hu
Applications: WB, ICC
NBP1-88567
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-01826
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB3241
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP

Publications for MRPS35 Antibody (NBP1-82786) (0)

There are no publications for MRPS35 Antibody (NBP1-82786).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS35 Antibody (NBP1-82786) (0)

There are no reviews for MRPS35 Antibody (NBP1-82786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS35 Antibody (NBP1-82786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPS35 Products

Bioinformatics Tool for MRPS35 Antibody (NBP1-82786)

Discover related pathways, diseases and genes to MRPS35 Antibody (NBP1-82786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS35 Antibody (NBP1-82786)

Discover more about diseases related to MRPS35 Antibody (NBP1-82786).
 

Pathways for MRPS35 Antibody (NBP1-82786)

View related products by pathway.

Blogs on MRPS35

There are no specific blogs for MRPS35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPS35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPS35