MRPL33 Antibody

Images

 
Immunohistochemistry: MRPL33 Antibody [NBP2-49496] - Staining of human heart muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL33 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MFLSAVFFAKSKSKNILVRMVSEAGTGFCFNTKRNRLREKLTLLHYDPVVKQRVLFVE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL33
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MRPL33 Recombinant Protein Antigen (NBP2-49496PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL33 Antibody

  • 39S ribosomal protein L33, mitochondrial
  • C2orf1
  • L33mt
  • MGC111093
  • MGC13694
  • MGC23922
  • mitochondrial ribosomal protein L33
  • MRP-L33
  • RPL33L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82855
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-38971
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84123
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-93788
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-51790
Species: Hu
Applications: PAGE
NBP3-17402
Species: Hu
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NBP1-56761
Species: Hu
Applications: WB
NBP2-16433
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-82057
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-80665
Species: Hu
Applications: IHC, IHC-P, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-88159
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24502
Species: Eq, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
NBP1-88382
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85525
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-49496
Species: Hu
Applications: IHC, IHC-P

Publications for MRPL33 Antibody (NBP2-49496) (0)

There are no publications for MRPL33 Antibody (NBP2-49496).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL33 Antibody (NBP2-49496) (0)

There are no reviews for MRPL33 Antibody (NBP2-49496). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MRPL33 Antibody (NBP2-49496) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL33 Products

Bioinformatics Tool for MRPL33 Antibody (NBP2-49496)

Discover related pathways, diseases and genes to MRPL33 Antibody (NBP2-49496). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MRPL33 Antibody (NBP2-49496)

View related products by pathway.

Blogs on MRPL33

There are no specific blogs for MRPL33, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL33 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL33