Home » ATAD2 » ATAD2 Antibodies » ATAD2 Antibody

ATAD2 Antibody

 (2 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: ATAD2 Antibody [NBP1-84123] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATAD2 antibody. Remaining relative intensity is presented.
Genetic Strategies: Western Blot: ATAD2 Antibody [NBP1-84123] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATAD2 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ATAD2 Antibody [NBP1-84123] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining in human testis and epididymis tissues using anti-ATAD2 antibody. Corresponding ATAD2 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human epididymis shows low expression as expected.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human testis shows high expression.
Simple Western: ATAD2 Antibody [NBP1-84123] - Simple Western lane view shows a specific band for ATAD2 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ATAD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Specificity
Specificity of human ATAD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATAD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Simple Western 1:50
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control
ATAD2 Knockout HeLa Cell Lysate
Control Peptide
ATAD2 Protein (NBP1-84123PEP)
Publications
Read Publications using
NBP1-84123 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 23393560)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATAD2 Antibody

  • AAA nuclear coregulator cancer-associated protein
  • ANCCA
  • ANCCAMGC131938
  • ATAD2
  • ATPase family AAA domain-containing protein 2
  • ATPase family, AAA domain containing 2
  • CT137
  • DKFZp667N1320
  • EC 3.6.1.3
  • MGC142216
  • MGC29843
  • MGC5254
  • PRO2000

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZACN Antibody
NBP1-80104
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
PPFIBP1 Antibody
NBP1-83192
Western Blot: PPFIBP1 Antibody [NBP1-83192] - Analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Immunocytochemistry/Immunofluorescence: PPFIBP1 Antibody [NBP1-83192] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Immunohistochemistry-Paraffin: PPFIBP1 Antibody [NBP1-83192] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
RPS3 Antibody
NBP1-33691
Western Blot: RPS3 Antibody [NBP1-33691] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPS3 antibody diluted at a dilution of 1:500.
Immunocytochemistry/Immunofluorescence: RPS3 Antibody [NBP1-33691] - Analysis of methanol-fixed HeLa, using RPS3 antibody (Green) at 1:500 dilution. Alpha-tubulin filaments were labeled with an alpha Tubulin antibody (Red) at 1:2000.
Immunohistochemistry-Paraffin: RPS3 Antibody [NBP1-33691] - Mouse intestine diluted at 1:500. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NCOA3/AIB1 Antibody
NB100-314
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Detection of Human SRC3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SRC3 antibody NB100-314 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Nuclear extract (5 mcg for WB, 10 mg for CoIP) from HeLa cells. Affinity purified rabbit anti-SRC3 used at 0.33 mcg/ml for WB and 20 mcg/10 mg extract for CoIP.
(1 Review)
(4 Publications)
Species: Hu
Applications: WB, IP
Proteasome 19S S3
Antibody (OTI2A2) - A ...
NBP2-73636
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prot
Flow Cytometry: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostaining by anti-Proteasome 19S S3 antibody, and then analyzed by flow cytometry.
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, CyTOF-ready
RPL11 Antibody
NBP2-20210
Western Blot: RPL11 Antibody [NBP2-20210] - Binding to six Anopheles gambiae pupal lysis samples at 21.8 kDa, and the murine control at 20.6 kDa. Image from a verified customer review.
Immunohistochemistry-Paraffin: RPL11 Antibody [NBP2-20210] - RPL11 antibody detects RPL11 protein at cytosol and nucleus on HeLa xenograft by immunohistochemical analysis. Sample: Paraffin-embedded HeLa xenograft. RPL11 antibody dilution: 1:500.
Western Blot: RPL11 Antibody [NBP2-20210] - Sample (30 ug of whole cell lysate) A: HeLa 12% SDS PAGE gel, diluted at 1:1000.
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
RPS10 Antibody
NBP2-97622
Western Blot: RPS10 Antibody [NBP2-97622] - Anti-RPS10 rabbit polyclonal antibody at 1:500 dilution. Lane A: Hela Whole Cell Lysate Lane B: K562 Whole Cell Lysate Lane C: Raji Whole Cell Lysate Lane D: U-251 MG Whole Cell Lysate Lysates/proteins at 30 ug per lane. Secondary Goat Anti-Rabbit IgG (H+L)/HRP at 1/10000 dilution. Developed using the ECL technique. Performed under reducing conditions. Predicted band size: 19 kDa. Observed band size: 19 kDa
Immunocytochemistry/Immunofluorescence: RPS10 Antibody [NBP2-97622] - Immunofluorescence staining of RPS10 in MCF7 cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS, blocked with 10% serum, and incubated with rabbit anti-Human RPS10 polyclonal antibody (dilution ratio 1:200) at 4C overnight. Then cells were stained with the Alexa Fluor(R)488-conjugated Goat Anti-rabbit IgG secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.
Immunohistochemistry-Paraffin: RPS10 Antibody [NBP2-97622] - Immunochemical staining of human RPS10 in human pancreas with rabbit polyclonal antibody at 1:100 dilution, formalin-fixed paraffin embedded sections.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
LASS2 Antibody
(1A6)
H00029956-M01A
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC
RPL3 Antibody
NBP2-20214
Western Blot: RPL3 Antibody [NBP2-20214] - Sample (30 ug of whole cell lysate) A: JurKat B: Raji 10% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP2-20214] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: RPL3 Antibody [NBP2-20214] - Paraffin-embedded mouse intestine diluted at 1:500.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
RPL27 Antibody
NBP2-94240
Western Blot: RPL27 Antibody [NBP2-94240] - Analysis of extracts of various cell lines, using RPL27. Exposure time: 90s.
Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP2-94240] - Analysis of U-2 OS cells using RPL27. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP2-94240] - Analysis of HeLa cells using RPL27 at dilution of 1:200. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
HN1L Antibody
NBP1-88446
Western Blot: HN1L Antibody [NBP1-88446] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: HN1L Antibody [NBP1-88446] - Staining of human cell line A-431 shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
RPL7 Antibody
NB100-2269
Western Blot: RPL7 Antibody [NB100-2269] - Detection of human and mouse RPL7 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TMCK-1, and mouse NIH 3T3 cells prepared using RIPA lysis buffer. Antibody: Affinity purified rabbit anti-RPL7 antibody NB100-2269 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
RPL18 Antibody
NBP2-13251
Western Blot: RPL18 Antibody [NBP2-13251] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: RPL18 Antibody [NBP2-13251] - Staining of human cell line HEK 293 shows localization to nucleoli, cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-13251] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Neuropeptide B
Antibody
NBP3-05567
Neuropeptide B Antibody
Species: Hu, Mu
Applications: WB, ICC/IF
PSMD6 Antibody
NBP1-81545
Western Blot: PSMD6 Antibody [NBP1-81545] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: PSMD6 Antibody [NBP1-81545] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human testis shows moderate nuclear and cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
TEX10
Overexpression Lysate
NBP2-06930
Western Blot: TEX10 Overexpression Lysate (Adult Normal) [NBP2-06930] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for TEX10.
Species: Hu
L1CAM Antibody
(UJ127.11)
NB100-2682
Western Blot: L1CAM Antibody (UJ127.11) [NB100-2682] - SUM159 cells were exposed to 20% or 1% O2 for 48 hours, whole cell lysates were loaded with 50 ug/lane. 10% SDS-PAGE. L1CAM Antibody (NB100-2682) primary antibody: 1:1000, 4C, overnight. Western blot image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: L1CAM Antibody (UJ127.11) [NB100-2682] - The left panel (A) shows untreated Neuro2a cells and the right panel (B) shows Neuro2a cells that were serum starved then treated with 1mM cAMP overnight to induce axon growth. Cells were fixed in 4% paraformaldehyde for 10 minutes and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti- NB100-2682 at 5 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunohistochemistry-Paraffin: L1CAM Antibody (UJ127.11) [NB100-2682] - Analysis of a FFPE tissue section of human brain using 1:200 dilution of L1CAM [UJ127.11] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Cytoplasmic and membrane staining as observed in the cerebral cortex
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-CS, IF
RPL6 Antibody
NBP2-20216
Western Blot: RPL6 Antibody [NBP2-20216] - Sample (30 ug of whole cell lysate) A: A549 B: H1299 C: HCT116 D: MCF-7 12% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: RPL6 Antibody [NBP2-20216] - Immunofluorescence analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded rat fore brain. RPL6 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
RPL15 Antibody
NBP2-20212
Western Blot: RPL15 Antibody [NBP2-20212] - Sample (30 ug of whole cell lysate) A: H1299 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RPL15 Antibody [NBP2-20212] - Human breast carcinoma. Sample: RPL15 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Immunohistochemistry-Paraffin: RPL15 Antibody [NBP2-20212] - Human normal colon, using RPL15 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Species: Hu
Applications: WB, IHC, IHC-P
RPL5 Antibody
NBP1-31413
Western Blot: RPL5 Antibody [NBP1-31413] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with RPL5 antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.
Immunohistochemistry-Paraffin: RPL5 Antibody [NBP1-31413] - Paraffin-embedded mouse hind brain. RPL5 antibody diluted at 1:500.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ATAD2 Antibody (NBP1-84123)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ATAD2 Antibody (NBP1-84123) (0)

There are no reviews for ATAD2 Antibody (NBP1-84123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATAD2 Antibody (NBP1-84123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

ATAD2 Knockout HeLa Cell Lysate

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ATAD2 Products

Bioinformatics Tool for ATAD2 Antibody (NBP1-84123)

Discover related pathways, diseases and genes to ATAD2 Antibody (NBP1-84123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATAD2 Antibody (NBP1-84123)

Discover more about diseases related to ATAD2 Antibody (NBP1-84123).
 

Pathways for ATAD2 Antibody (NBP1-84123)

View related products by pathway.

PTMs for ATAD2 Antibody (NBP1-84123)

Learn more about PTMs related to ATAD2 Antibody (NBP1-84123).
 

Research Areas for ATAD2 Antibody (NBP1-84123)

Find related products by research area.

Blogs on ATAD2

There are no specific blogs for ATAD2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAD2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATAD2
Entrez
Uniprot