ATAD2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Analysis in human testis and skeletal muscle tissues using NBP1-84123 antibody. Corresponding ATAD2 RNA-seq data are presented ...read more
Genetic Strategies: Western Blot: ATAD2 Antibody [NBP1-84123] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATAD2 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ATAD2 Antibody [NBP1-84123] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Bone marrow shows strong nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Lymph node shows moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.
Simple Western: ATAD2 Antibody [NBP1-84123] - Simple Western lane view shows a specific band for ATAD2 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ATAD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATAD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
  • Simple Western 1:50
  • Western Blot 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
ATAD2 Protein (NBP1-84123PEP)
Publications
Read Publications using
NBP1-84123 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 23393560)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATAD2 Antibody

  • AAA nuclear coregulator cancer-associated protein
  • ANCCA
  • ANCCAMGC131938
  • ATAD2
  • ATPase family AAA domain-containing protein 2
  • ATPase family, AAA domain containing 2
  • CT137
  • DKFZp667N1320
  • EC 3.6.1.3
  • MGC142216
  • MGC29843
  • MGC5254
  • PRO2000

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-80104
Species: Hu
Applications: WB
NBP1-83192
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67301
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-314
Species: Hu
Applications: IP, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP2-20210
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
NBP2-94502
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00029956-M01A
Species: Hu, Mu
Applications: ELISA, IHC, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-94240
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88446
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-2269
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-05567
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-81545
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09260
Species: Hu
Applications: WB
NB100-2682
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-20212
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for ATAD2 Antibody (NBP1-84123)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ATAD2 Antibody (NBP1-84123) (0)

There are no reviews for ATAD2 Antibody (NBP1-84123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATAD2 Antibody (NBP1-84123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATAD2 Products

Bioinformatics Tool for ATAD2 Antibody (NBP1-84123)

Discover related pathways, diseases and genes to ATAD2 Antibody (NBP1-84123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATAD2 Antibody (NBP1-84123)

Discover more about diseases related to ATAD2 Antibody (NBP1-84123).
 

Pathways for ATAD2 Antibody (NBP1-84123)

View related products by pathway.

PTMs for ATAD2 Antibody (NBP1-84123)

Learn more about PTMs related to ATAD2 Antibody (NBP1-84123).
 

Research Areas for ATAD2 Antibody (NBP1-84123)

Find related products by research area.

Blogs on ATAD2

There are no specific blogs for ATAD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAD2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ATAD2
Entrez
Uniprot