Home » ATAD2 » ATAD2 Antibodies » ATAD2 Antibody

ATAD2 Antibody

 (2 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Analysis in human testis and skeletal muscle tissues using NBP1-84123 antibody. Corresponding ATAD2 RNA-seq data are presented for the same tissues.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Analysis in human testis and skeletal muscle tissues using NBP1-84123 antibody. Corresponding ATAD2 RNA-seq data are presented ...read more
Genetic Strategies: Western Blot: ATAD2 Antibody [NBP1-84123] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATAD2 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: ATAD2 Antibody [NBP1-84123] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Skeletal muscle shows very weak positivity in myocytes.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Bone marrow shows strong nuclear positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Lymph node shows moderate nuclear positivity in non-germinal center cells.
Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human Testis shows strong nuclear positivity in cells in seminiferous ducts.
Simple Western: ATAD2 Antibody [NBP1-84123] - Simple Western lane view shows a specific band for ATAD2 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 66-440 kDa ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

  

Orthogonal Strategies

  

Order Details

100% Guarantee on every product

ATAD2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ATAD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
  • Simple Western 1:50
  • Western Blot 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
ATAD2 Protein (NBP1-84123PEP)
Publications
Read Publications using
NBP1-84123 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 23393560)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ATAD2 Antibody

  • AAA nuclear coregulator cancer-associated protein
  • ANCCA
  • ANCCAMGC131938
  • ATAD2
  • ATPase family AAA domain-containing protein 2
  • ATPase family, AAA domain containing 2
  • CT137
  • DKFZp667N1320
  • EC 3.6.1.3
  • MGC142216
  • MGC29843
  • MGC5254
  • PRO2000

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ZACN Antibody
NBP1-80104
Western Blot: ZACN Antibody [NBP1-80104] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
PPFIBP1 Antibody
NBP1-83192
Immunohistochemistry-Paraffin: PPFIBP1 Antibody [NBP1-83192] - Staining of human skin shows moderate cytoplasmic positivity in epidermal cells and adnexal cells.
Immunocytochemistry/Immunofluorescence: PPFIBP1 Antibody [NBP1-83192] - Staining of human cell line U-2 OS shows localization to plasma membrane and cytosol.
Western Blot: PPFIBP1 Antibody [NBP1-83192] - Analysis in human cell lines Caco-2 and HEK293 using Anti-PPFIBP1 antibody. Corresponding PPFIBP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RPS3 Antibody
(SA46-08)
NBP2-67301
Immunocytochemistry/Immunofluorescence: RPS3 Antibody (SA46-08) [NBP2-67301] - Staining RPS3 in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: RPS3 Antibody (SA46-08) [NBP2-67301] - Analysis of paraffin-embedded human kidney tissue using anti-RPS3 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: RPS3 Antibody (SA46-08) [NBP2-67301] - Analysis of paraffin-embedded mouse lung tissue using anti-RPS3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NCOA3/AIB1 Antibody
NB100-314
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Nuclear extract (5 mcg for WB, 10 mg for CoIP) from HeLa cells. Affinity purified rabbit anti-SRC3 used at 0.33 mcg/ml for WB and 20 mcg/10 mg extract for CoIP.
Western Blot: NCOA3/AIB1 Antibody [NB100-314] - Detection of Human SRC3 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SRC3 antibody NB100-314 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.
(1 Review)
(4 Publications)
Species: Hu
Applications: IP, WB
Proteasome 19S S3
Antibody (OTI2A2) - A ...
NBP2-73636
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of extracts (35ug) from 9 different cell lines by using anti-Proteasome 19S S3 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Western Blot: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Proteasome 19S S3 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prot
Flow Cytometry: Proteasome 19S S3 Antibody (OTI2A2) - Azide and BSA Free [NBP2-73636] - Analysis of Hela cells, using anti-Proteasome 19S S3 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
RPL11 Antibody
NBP2-20210
Western Blot: RPL11 Antibody [NBP2-20210] - Binding to six Anopheles gambiae pupal lysis samples at 21.8 kDa, and the murine control at 20.6 kDa. Image from a verified customer review.
Western Blot: RPL11 Antibody [NBP2-20210] - Sample (30 ug of whole cell lysate) A: HeLa 12% SDS PAGE gel, diluted at 1:1000.
Western Blot: RPL11 Antibody [NBP2-20210] - Sample (50 ug of whole cell lysate) A: Mouse Liver, 12% SDS PAGE gel, diluted at 1:1000.
(1 Review)
Species: Hu, I, Mu
Applications: IHC, IHC-P, WB
RPS10 Antibody
NBP2-94502
Immunocytochemistry/Immunofluorescence: RPS10 Antibody [NBP2-94502] - Analysis of MCF7 cells using RPS10 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: RPS10 Antibody [NBP2-94502] - Mouse brain using RPS10 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: RPS10 Antibody [NBP2-94502] - Rat brain using RPS10 antibody at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
LASS2 Antibody
(1A6)
H00029956-M01A
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6 Western Blot analysis of LASS2 expression in HepG2.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - S2 monoclonal antibody (M01), clone 1A6. Western Blot analysis of LASS2 expression in NIH/3T3.
Western Blot: LASS2 Antibody (1A6) [H00029956-M01A] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ELISA, IHC, WB
RPL3 Antibody
NBP2-20214
Western Blot: RPL3 Antibody [NBP2-20214] - Sample (30 ug of whole cell lysate) A: JurKat B: Raji 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RPL3 Antibody [NBP2-20214] - 4T1 xenograft, using RPL3 antibody at 1:500 dilution. Antigen Retrieval: Citrate buffer, pH 6.0, 15 min.
Immunocytochemistry/Immunofluorescence: RPL3 Antibody [NBP2-20214] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
RPL27 Antibody
NBP2-94240
Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP2-94240] - Analysis of HeLa cells using RPL27 at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP2-94240] - Analysis of C6 cells using RPL27 . Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: RPL27 Antibody [NBP2-94240] - Analysis of L929 cells using RPL27 . Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
HN1L Antibody
NBP1-88446
Western Blot: HN1L Antibody [NBP1-88446] - Analysis in human cell line TD47D.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human Fallopian tube shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HN1L Antibody [NBP1-88446] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RPL7 Antibody
NB100-2269
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: RPL7 Antibody [NB100-2269] - Detection of human and mouse RPL7 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TMCK-1, and mouse NIH 3T3 cells prepared using RIPA lysis buffer. Antibody: Affinity purified rabbit anti-RPL7 antibody NB100-2269 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
(1 Review)
(8 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
RPL18 Antibody
NBP2-13251
Immunohistochemistry-Paraffin: RPL18 Antibody [NBP2-13251] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunocytochemistry/Immunofluorescence: RPL18 Antibody [NBP2-13251] - Staining of human cell line HEK 293 shows localization to nucleoli, cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Western Blot: RPL18 Antibody [NBP2-13251] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Neuropeptide B
Antibody
NBP3-05567
Immunocytochemistry/Immunofluorescence: Neuropeptide B Antibody [NBP3-05567] - Immunofluorescence analysis of HeLa cells using Neuropeptide B Rabbit pAb (NBP3-05567) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Neuropeptide B Antibody [NBP3-05567] - Immunofluorescence analysis of NIH/3T3 cells using Neuropeptide B Rabbit pAb (NBP3-05567) at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: Neuropeptide B Antibody [NBP3-05567] - Western blot analysis of extracts of various cell lines, using Neuropeptide B antibody (NBP3-05567) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Species: Hu, Mu
Applications: ICC/IF, WB
PSMD6 Antibody
NBP1-81545
Immunocytochemistry/Immunofluorescence: PSMD6 Antibody [NBP1-81545] - Staining of human cell line A-431 shows localization to the Golgi apparatus & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.
Immunohistochemistry-Paraffin: PSMD6 Antibody [NBP1-81545] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TEX10 Antibody
NBP3-09260
Western Blot: TEX10 Antibody [NBP3-09260] - Western blot analysis of TEX10 in Fetal Brain lysates. Antibody dilution at 1.0ug/ml
Species: Hu
Applications: WB
L1CAM Antibody
(UJ127.11) - BSA Free
NB100-2682
Flow Cytometry: L1CAM Antibody (UJ127.11) [NB100-2682] - A surface stain was performed on HeLa cells with L1CAM Antibody (UJ127.11) NB100-2682 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 2.5 ug/mL for 20 minutes at room temperature, followed by Mouse IgG (H+L) Cross-Adsorbed Secondary Antibody, Dylight 550 (35503, Thermo Fisher).
Western Blot: L1CAM Antibody (UJ127.11) [NB100-2682] - Total protein from human HeLa, A431 and SHSY-5Y cell lines and human Brain was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2.0 ug/ml anti-L1CAM (NB100-2682) in blocking buffer and detected with an anti-mouse HRP secondary antibody using NovaLume chemiluminescence detection reagent (NPB2-61915).
Immunohistochemistry-Paraffin: L1CAM Antibody (UJ127.11) [NB100-2682] - Analysis of a FFPE tissue section of human brain using 1:200 dilution of L1CAM [UJ127.11] antibody. The staining was developed using HRP labeled anti-mouse secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. Cytoplasmic and membrane staining as observed in the cerebral cortex
(2 Reviews)
(2 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P, IP, WB
RPL6 Antibody
NBP2-20216
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded lung carcinoma. RPL6 antibody dilution: 1:500.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded mouse stomach. RPL6 antibody dilution: 1:500.
Immunohistochemistry-Paraffin: RPL6 Antibody [NBP2-20216] - Paraffin-embedded rat fore brain. RPL6 antibody dilution: 1:500.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
RPL15 Antibody
NBP2-20212
Immunohistochemistry-Paraffin: RPL15 Antibody [NBP2-20212] - Human breast carcinoma. Sample: RPL15 antibody dilution: 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Western Blot: RPL15 Antibody [NBP2-20212] - Sample (30 ug of whole cell lysate) A: H1299 12% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RPL15 Antibody [NBP2-20212] - Human normal colon, using RPL15 antibody at 1:500 dilution. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min
Species: Hu
Applications: IHC, IHC-P, WB
RPL5 Antibody
NBP1-31413
Immunocytochemistry/Immunofluorescence: RPL5 Antibody [NBP1-31413] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: RPL5 protein stained by RPL5 antibody diluted at 1:500. Blue: Hoechst 33342 staining.Scale bar = 10 um.
Knockdown Validated: RPL5 Antibody [NBP1-31413] - Western Blot analysis of RPL5 protein expressions in CD71highTer119high cells. There was a significant decrease in the expression level of RPL5 in the treated shRNA Rpl5 compared to the control mice. Image collected and cropped by CiteAb from the following publication (www.discoveriesjournals.org/discoveries/D.2019.03.DI-Kazerounian-Beggs.DOI) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: RPL5 Antibody [NBP1-31413] - Mouse hind brain. RPL5 antibody diluted at 1:500. Antigen Retrieval: Trilogy™ (EDTA based, pH 8.0) buffer, 15min.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB

Publications for ATAD2 Antibody (NBP1-84123)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ATAD2 Antibody (NBP1-84123) (0)

There are no reviews for ATAD2 Antibody (NBP1-84123). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ATAD2 Antibody (NBP1-84123) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ATAD2 Products

Bioinformatics Tool for ATAD2 Antibody (NBP1-84123)

Discover related pathways, diseases and genes to ATAD2 Antibody (NBP1-84123). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ATAD2 Antibody (NBP1-84123)

Discover more about diseases related to ATAD2 Antibody (NBP1-84123).
 

Pathways for ATAD2 Antibody (NBP1-84123)

View related products by pathway.

PTMs for ATAD2 Antibody (NBP1-84123)

Learn more about PTMs related to ATAD2 Antibody (NBP1-84123).
 

Research Areas for ATAD2 Antibody (NBP1-84123)

Find related products by research area.

Blogs on ATAD2

There are no specific blogs for ATAD2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ATAD2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ATAD2
Entrez
Uniprot