ATAD2 Antibody

Western Blot: ATAD2 Antibody [NBP1-84123] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATAD2 antibody. Remaining relative intensity is presented.

Immunocytochemistry/Immunofluorescence: ATAD2 Antibody [NBP1-84123] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining in human testis and epididymis tissues using anti-ATAD2 antibody. Corresponding ATAD2 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human epididymis shows low expression as expected.

Immunohistochemistry-Paraffin: ATAD2 Antibody [NBP1-84123] - Staining of human testis shows high expression.

Simple Western: ATAD2 Antibody [NBP1-84123] - Simple Western lane view shows a specific band for ATAD2 in 0.2 mg/ml of U-251MG sp lysate. This experiment was performed under reducing conditions using the 66-440 kDa separation system.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ATAD2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSDPEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHK
• Specificity: Specificity of human ATAD2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ATAD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.4 ug/ml
  • Simple Western 1:50
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Positive Control:

  ATAD2 Lysate (NBP2-64885)

• Control Peptide:

  ATAD2 Protein (NBP1-84123PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%). Reactivity reported in scientific literature (PMID: 23393560)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ATAD2 Antibody

• AAA nuclear coregulator cancer-associated protein
• ANCCA
• ANCCAMGC131938
• ATAD2
• ATPase family AAA domain-containing protein 2
• ATPase family, AAA domain containing 2
• CT137
• DKFZp667N1320
• EC 3.6.1.3
• MGC142216
• MGC29843
• MGC5254
• PRO2000

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ATAD2 Antibody (NBP1-84123)(2)

Publications using NBP1-84123

• Wan WN, Zhang YX, Wang XM et al. ATAD2 is highly expressed in ovarian carcinomas and indicates poor prognosis. Asian Pac J Cancer Prev 2014 [PMID: 24761900] (IHC, Human)
• Raeder MB, Birkeland E, Trovik J et al. Integrated Genomic Analysis of the 8q24 Amplification in Endometrial Cancers Identifies ATAD2 as Essential to MYC-Dependent Cancers. PLoS One 2013 [PMID: 23393560]

Bioinformatics

• Gene Symbol: ATAD2
• Entrez:
  • 29028(Human)
  • 70472(Mouse)
  • 314993(Rat)
• Uniprot:
  • Q6PL18()