Ribosomal Protein L24 Antibody - Azide and BSA Free

Images

 
Western Blot: Ribosomal Protein L24 Antibody - Azide and BSA Free [Ribosomal Protein L24] - Western blot analysis of various lysates using Ribosomal Protein L24 Rabbit pAb at 1:1000 dilution. Secondary antibody: HRP ...read more
Immunocytochemistry/ Immunofluorescence: Ribosomal Protein L24 Antibody [NBP2-93788] - Analysis of L929 cells using Ribosomal Protein L24 . Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: Ribosomal Protein L24 Antibody [NBP2-93788] - Paraffin-embedded human thyroid cancer using Ribosomal Protein L24 .
Immunohistochemistry-Paraffin: Ribosomal Protein L24 Antibody [NBP2-93788] - Paraffin-embedded human colon carcinoma using Ribosomal Protein L24 .

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

Ribosomal Protein L24 Antibody - Azide and BSA Free Summary

Description
Novus Biologicals Rabbit Ribosomal Protein L24 Antibody - Azide and BSA Free (NBP2-93788) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 38-157 of human RPL24 (NP_000977.1). SAFLSKRNPRQINWTVLYRRKHKKGQSEEIQKKRTRRAVKFQRAITGASLADIMAKRNQKPEVRKAQREQAIRAAKEAKKAKQASKKTAMAAAKAPTKAAPKQKIVKPVKVSAPRVGGKR
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RPL24
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50-1:100
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500-1:2000
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.01% Thimerosal
Purity
Affinity purified

Alternate Names for Ribosomal Protein L24 Antibody - Azide and BSA Free

  • 60S ribosomal protein L24
  • 60S ribosomal protein L30
  • L24
  • ribosomal protein L30
  • RPL24

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L24E family of ribosomal proteins. It is located in the cytoplasm. This gene has been referred to as ribosomal protein L30 because the encoded protein shares amino acid identity with the L30 ribosomal proteins from S. cerevisiae; however, its official name is ribosomal protein L24. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35377
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-38992
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85385
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00006124-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP3-12600
Species: Hu
Applications: ICC/IF,  IHC-P, IP, WB
NBP2-20212
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-31413
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-20216
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-20214
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
H00058516-B02P
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-27806
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IP, WB
NBP1-87847
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81328
Species: Hu
Applications: ICC/IF, WB
MAB8164
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IHC
NBP2-20210
Species: Hu, I, Mu, Ze
Applications: IHC-WhMt, IHC,  IHC-P, WB
NBP2-13251
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87372
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88445
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84537
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-93788
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Publications for Ribosomal Protein L24 Antibody (NBP2-93788) (0)

There are no publications for Ribosomal Protein L24 Antibody (NBP2-93788).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ribosomal Protein L24 Antibody (NBP2-93788) (0)

There are no reviews for Ribosomal Protein L24 Antibody (NBP2-93788). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Ribosomal Protein L24 Antibody (NBP2-93788) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ribosomal Protein L24 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol RPL24