CDC42EP3 Antibody

Western Blot: CDC42EP3 Antibody [NBP1-88382] - Analysis in control (vector only transfected HEK293T lysate) and CDC42EP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: CDC42EP3 Antibody [NBP1-88382] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

CDC42EP3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSW
• Predicted Species: Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDC42EP3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CDC42EP3 Protein (NBP1-88382PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CDC42EP3 Antibody

• Binder of Rho GTPases 2
• BORG2CEP3UB1
• CDC42 effector protein (Rho GTPase binding) 3
• cdc42 effector protein 3
• CRIB-containing BORG2 protein
• FLJ46903
• MSE55-related Cdc42-binding protein
• MSE55-related protein

Background

CDC42, a small Rho GTPase, regulates the formation of F-actin-containing structures through its interaction with the downstream effector proteins. The protein encoded by this gene is a member of the Borg family of CDC42 effector proteins. Borg family proteins contain a CRIB (Cdc42/Rac interactive-binding) domain. They bind to, and negatively regulate the function of, CDC42. This protein can interact with CDC42, as well as with the ras homolog gene family, member Q (ARHQ/TC10). Expression of this protein in fibroblasts has been shown to induce pseudopodia formation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CDC42EP3 Antibody (NBP1-88382)(4)

Publications using NBP1-88382

• Yang Z, Xu T, Xie T et al. CDC42EP3 promotes glioma progression via regulation of CCND1 Cell death & disease [PMID: 35365622]
• Xu P, Li X, Tang C et al. Deduction of CDC42EP3 suppress development and progression of osteosarcoma Experimental Cell Research 2022-01-01 [PMID: 34998812] (WB, IHC-P, Human)
• Chen W, Zhu Y, Zhang W et al. CDC42EP3 is a key promoter involved in the development and progression of gastric cancer Carcinogenesis 2021-06-10 [PMID: 34111280]
• Zhang C, Shen Y, Gao L et al. Targeting POLE2 Creates a Novel Vulnerability in Renal Cell Carcinoma via Modulating Stanniocalcin 1 Frontiers in Cell and Developmental Biology 2021-02-11 [PMID: 33644060] (WB, Human)

Bioinformatics

• Gene Symbol: CDC42EP3