CDC42EP3 Antibody


Western Blot: CDC42EP3 Antibody [NBP1-88382] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed more
Immunohistochemistry-Paraffin: CDC42EP3 Antibody [NBP1-88382] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CDC42EP3 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSW
Specificity of human CDC42EP3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDC42EP3 Protein (NBP1-88382PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CDC42EP3 Antibody

  • Binder of Rho GTPases 2
  • CDC42 effector protein (Rho GTPase binding) 3
  • cdc42 effector protein 3
  • CRIB-containing BORG2 protein
  • FLJ46903
  • MSE55-related Cdc42-binding protein
  • MSE55-related protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: Flow, CyTOF-reported
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CDC42EP3 Antibody (NBP1-88382) (0)

There are no publications for CDC42EP3 Antibody (NBP1-88382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42EP3 Antibody (NBP1-88382) (0)

There are no reviews for CDC42EP3 Antibody (NBP1-88382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42EP3 Antibody (NBP1-88382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CDC42EP3 Products

Bioinformatics Tool for CDC42EP3 Antibody (NBP1-88382)

Discover related pathways, diseases and genes to CDC42EP3 Antibody (NBP1-88382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42EP3 Antibody (NBP1-88382)

Discover more about diseases related to CDC42EP3 Antibody (NBP1-88382).

Pathways for CDC42EP3 Antibody (NBP1-88382)

View related products by pathway.

PTMs for CDC42EP3 Antibody (NBP1-88382)

Learn more about PTMs related to CDC42EP3 Antibody (NBP1-88382).

Blogs on CDC42EP3

There are no specific blogs for CDC42EP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CDC42EP3 Antibody and receive a gift card or discount.


Gene Symbol CDC42EP3