CDC42EP3 Antibody

Images

 
Western Blot: CDC42EP3 Antibody [NBP1-88382] - Analysis in control (vector only transfected HEK293T lysate) and CDC42EP3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: CDC42EP3 Antibody [NBP1-88382] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42EP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SLPTIGGSQALMLPLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSW
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42EP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDC42EP3 Protein (NBP1-88382PEP)
Publications
Read Publications using
NBP1-88382 in the following applications:

  • 1 publication
  • WB
    2 publications

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42EP3 Antibody

  • Binder of Rho GTPases 2
  • BORG2CEP3UB1
  • CDC42 effector protein (Rho GTPase binding) 3
  • cdc42 effector protein 3
  • CRIB-containing BORG2 protein
  • FLJ46903
  • MSE55-related Cdc42-binding protein
  • MSE55-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88379
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
H00023580-P01
Species: Hu
Applications: ELISA, AP, In vitro, PA, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-88383
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47525
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67147
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-91773
Species: Hu
Applications: IHC, IHC-P, WB
MAB2014
Species: Hu
Applications: CyTOF-reported, Flow
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB
NBP2-16195
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-92044
Species: Hu, Mu
Applications: WB
NBP2-75607
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP2-73636
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: CyTOF-ready, Flow, WB
NBP1-87132
Species: Hu
Applications: IHC, IHC-P, WB
AF284
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NBP1-48308
Species: Bv, Hu, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
NBP2-45514
Species: Hu, Mu, Rt
Applications: IHC, WB

Publications for CDC42EP3 Antibody (NBP1-88382)(3)

Reviews for CDC42EP3 Antibody (NBP1-88382) (0)

There are no reviews for CDC42EP3 Antibody (NBP1-88382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42EP3 Antibody (NBP1-88382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CDC42EP3 Products

Bioinformatics Tool for CDC42EP3 Antibody (NBP1-88382)

Discover related pathways, diseases and genes to CDC42EP3 Antibody (NBP1-88382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42EP3 Antibody (NBP1-88382)

Discover more about diseases related to CDC42EP3 Antibody (NBP1-88382).
 

Pathways for CDC42EP3 Antibody (NBP1-88382)

View related products by pathway.

PTMs for CDC42EP3 Antibody (NBP1-88382)

Learn more about PTMs related to CDC42EP3 Antibody (NBP1-88382).

Blogs on CDC42EP3

There are no specific blogs for CDC42EP3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42EP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42EP3