CCDC5 Antibody

Images

 
Western Blot: CCDC5 Antibody [NBP1-88159] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: CCDC5 Antibody [NBP1-88159] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: CCDC5 Antibody [NBP1-88159] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEERETQVAAWLKKIFGDHPIPQYEVNPRTTEILHHLSERNRVRDRDVYLVIEDLKQKASEYESEAKYLQDLLMESVNFSPANLSSTGSRYLNALVD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HAUS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC5 Protein (NBP1-88159PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC5 Antibody

  • CCDC5Enhancer of invasion-cluster
  • coiled-coil domain containing 5 (spindle associated)
  • FLJ40084
  • HAUS augmin-like complex subunit 1
  • HAUS augmin-like complex, subunit 1
  • HEI-CCoiled-coil domain-containing protein 5
  • HEICFLJ21094
  • HsT1461

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88762
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80786
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6108
Species: Hu
Applications: IHC
NBP2-49496
Species: Hu
Applications: IHC
NBP1-92179
Species: Hu
Applications: IHC, IHC-P
H00051053-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-56761
Species: Hu
Applications: WB
NBP1-06398
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16433
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-58906
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-88581
Species: Hu
Applications: IHC, IHC-P
NBP2-20675
Species: Hu
Applications: WB, ICC/IF
NBP1-80665
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-97868
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP

Publications for CCDC5 Antibody (NBP1-88159) (0)

There are no publications for CCDC5 Antibody (NBP1-88159).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC5 Antibody (NBP1-88159) (0)

There are no reviews for CCDC5 Antibody (NBP1-88159). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC5 Antibody (NBP1-88159) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC5 Products

Bioinformatics Tool for CCDC5 Antibody (NBP1-88159)

Discover related pathways, diseases and genes to CCDC5 Antibody (NBP1-88159). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC5 Antibody (NBP1-88159)

Discover more about diseases related to CCDC5 Antibody (NBP1-88159).
 

Pathways for CCDC5 Antibody (NBP1-88159)

View related products by pathway.

Research Areas for CCDC5 Antibody (NBP1-88159)

Find related products by research area.

Blogs on CCDC5

There are no specific blogs for CCDC5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HAUS1