MRPL19 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRPL19 Antibody [NBP2-56761] - Staining of human cell line HEK 293 shows localization to mitochondria.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL19 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LRVTTADPYASGKISQFLGICIQRSGRGLGATFILRNVIEGQGVEICFELYNPRVQEIQVVKLEKRLDDSLLYLRDALPEYST
Specificity
Specificity of human MRPL19 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL19
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL19 Recombinant Protein Antigen (NBP2-56761PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MRPL19 Antibody

  • KIAA0104L19mt
  • L15mt
  • MGC20675
  • mitochondrial ribosomal protein L19
  • mitochondrial
  • MRPL1539S ribosomal protein L19, mitochondrial
  • MRP-L15MRP-L19
  • RLX1
  • RPML15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ca, Ch, ChHa, Eq, Fe, Ha, Ma-Op, Pm, Rb, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Single-Cell Western
NBP1-68766
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
H00006936-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-93472
Species: Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-84298
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, Gp, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze, Dr(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ChIP, KD, KO
NB500-317
Species: Hu, Bv(-), Ca(-), Ch(-), Mu(-), Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, RIA
NB100-64792
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF3589
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-33527
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1749
Species: Rt
Applications: WB, IHC
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-259
Species: Hu, Mu
Applications: WB, GS, ICC/IF, IP
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
MAB4219
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
NBP2-19784
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PLA
NBP1-57578
Species: Hu
Applications: WB
NBP2-56410
Species: Hu
Applications: WB, IHC, IHC-P, KD

Publications for MRPL19 Antibody (NBP2-56761) (0)

There are no publications for MRPL19 Antibody (NBP2-56761).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL19 Antibody (NBP2-56761) (0)

There are no reviews for MRPL19 Antibody (NBP2-56761). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRPL19 Antibody (NBP2-56761) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRPL19 Products

Bioinformatics Tool for MRPL19 Antibody (NBP2-56761)

Discover related pathways, diseases and genes to MRPL19 Antibody (NBP2-56761). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL19 Antibody (NBP2-56761)

Discover more about diseases related to MRPL19 Antibody (NBP2-56761).
 

Pathways for MRPL19 Antibody (NBP2-56761)

View related products by pathway.

Blogs on MRPL19

There are no specific blogs for MRPL19, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL19 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL19