MRP4/ABCC4 Antibody (1B2)

Images

 
Western Blot: MRP4/ABCC4 Antibody (1B2) [H00010257-M03] - Analysis of ABCC4 expression in Hela S3 NE (Cat # L013V3).
Immunohistochemistry-Paraffin: MRP4/ABCC4 Antibody (1B2) [H00010257-M03] - Analysis of monoclonal antibody to ABCC4 on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
Sandwich ELISA: MRP4/ABCC4 Antibody (1B2) [H00010257-M03] - Detection limit for recombinant GST tagged ABCC4 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1B2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MRP4/ABCC4 Antibody (1B2) Summary

Immunogen
ABCC4 (AAH41560, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPVYQEVKPNPLQDANLCSRVFFWWLNPLFKIGHKRRLEEDDMYSVLPEDRSQHLGEELQGFWDKEVLRAENDAQKPSLTRAIIKCYWKSYLVLGIFTLIEESAKVIQP
Specificity
ABCC4
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ABCC4
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Sandwich ELISA
Application Notes
Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA and immunohistochemistry (paraffin).
Control
HeLa Whole Cell Lysate
Publications
Read Publications using
H00010257-M03 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MRP4/ABCC4 Antibody (1B2)

  • ABCC4
  • ATP-binding cassette sub-family C member 4
  • ATP-binding cassette, sub-family C (CFTR/MRP), member 4
  • EST170205
  • MOATB
  • MOAT-BbA464I2.1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 4)
  • MOATBcanalicular multispecific organic anion transporter (ABC superfamily)
  • MRP4
  • MRP4MRP/cMOAT-related ABC transporter
  • multidrug resistance-associated protein 4
  • multispecific organic anion transporter B
  • Multi-specific organic anion transporter B

Background

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined; however, this protein may play a role in cellular detoxification as a pump for its substrate, organic anions. Alternative splicing results in multiple splice variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
NBP2-66958
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-46467
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37923
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67667
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-76670
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00065108-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-57299
Species: Hu
Applications: WB, IHC, IHC-P
NB100-556
Species: Hu
Applications: WB, IP
NBP2-19417
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58327
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89319
Species: Hu
Applications: IHC, IHC-P
NBP2-13415
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009376-B01P
Species: Hu, Rt
Applications: WB, IHC
NBP1-42342
Species: Hu
Applications: WB, Flow, IHC, IHC-Fr
NBP1-32822
Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for MRP4/ABCC4 Antibody (H00010257-M03)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MRP4/ABCC4 Antibody (H00010257-M03) (0)

There are no reviews for MRP4/ABCC4 Antibody (H00010257-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MRP4/ABCC4 Antibody (H00010257-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRP4/ABCC4 Products

Bioinformatics Tool for MRP4/ABCC4 Antibody (H00010257-M03)

Discover related pathways, diseases and genes to MRP4/ABCC4 Antibody (H00010257-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRP4/ABCC4 Antibody (H00010257-M03)

Discover more about diseases related to MRP4/ABCC4 Antibody (H00010257-M03).
 

Pathways for MRP4/ABCC4 Antibody (H00010257-M03)

View related products by pathway.

PTMs for MRP4/ABCC4 Antibody (H00010257-M03)

Learn more about PTMs related to MRP4/ABCC4 Antibody (H00010257-M03).

Blogs on MRP4/ABCC4

There are no specific blogs for MRP4/ABCC4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRP4/ABCC4 Antibody (1B2) and receive a gift card or discount.

Bioinformatics

Gene Symbol ABCC4
Entrez
OMIM
Uniprot