MRCK Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MRCK Antibody [NBP2-55964] - Staining of human cell line SiHa shows localization to intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MRCK Antibody [NBP2-55964] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRCK Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD
Specificity
Specificity of human MRCK antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42BPA
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MRCK Antibody

  • CDC42 binding protein kinase alpha (DMPK-like)
  • CDC42 binidng protein kinase beta
  • CDC42-binding protein kinase alpha (DMPK-like)
  • CDC42-binding protein kinase alpha
  • DMPK-like alpha
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0451DKFZp686L1738
  • MRCK alpha
  • MRCK
  • MRCKADKFZp686P1738
  • Myotonic dystrophy kinase-related CDC42-binding kinase alpha
  • myotonic dystrophy kinase-related CDC42-binding protein kinase alpha
  • Myotonic dystrophy protein kinase-like alpha
  • PK428FLJ23347
  • serine/threonine-protein kinase MRCK alpha
  • ser-thr protein kinase PK428
  • ser-thr protein kinase related to the myotonic dystrophy protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6967
Species: Hu
Applications: WB
NBP2-67895
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-47602
Species: Hu, Mu, Bv, Vb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-81555
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-81440
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NB100-79840
Species: Hu
Applications: WB (-), IP
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF2584
Species: Mu
Applications: WB, Simple Western
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30249
Species: Hu, Mu, Xp
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-38938
Species: Hu
Applications: IHC, IHC-P
NBP2-62682
Species: Hu
Applications: IHC, IHC-P

Publications for MRCK Antibody (NBP2-55964) (0)

There are no publications for MRCK Antibody (NBP2-55964).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRCK Antibody (NBP2-55964) (0)

There are no reviews for MRCK Antibody (NBP2-55964). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRCK Antibody (NBP2-55964) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MRCK Products

Array NBP2-55964

Bioinformatics Tool for MRCK Antibody (NBP2-55964)

Discover related pathways, diseases and genes to MRCK Antibody (NBP2-55964). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRCK Antibody (NBP2-55964)

Discover more about diseases related to MRCK Antibody (NBP2-55964).
 

Pathways for MRCK Antibody (NBP2-55964)

View related products by pathway.

PTMs for MRCK Antibody (NBP2-55964)

Learn more about PTMs related to MRCK Antibody (NBP2-55964).
 

Research Areas for MRCK Antibody (NBP2-55964)

Find related products by research area.

Blogs on MRCK

There are no specific blogs for MRCK, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRCK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42BPA