CDC42BPB Antibody

Images

 
Western Blot: CDC42BPB Antibody [NBP1-81440] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry: CDC42BPB Antibody [NBP1-81440] - Staining of human gall bladder shows strong cytoplasmic positivity in glandular cells.
Western Blot: CDC42BPB Antibody [NBP1-81440] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CDC42BPB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST
Specificity
Specificity of human, mouse, rat CDC42BPB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDC42BPB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CDC42BPB Protein (NBP1-81440PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CDC42BPB Antibody

  • CDC42 binding protein kinase beta (DMPK-like)
  • CDC42-binding protein kinase beta (DMPK-like)
  • CDC42-binding protein kinase beta
  • DMPK-like beta
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ37601
  • FLJ44730
  • KIAA1124DKFZp686H1431
  • MRCK beta
  • MRCKB
  • Myotonic dystrophy kinase-related CDC42-binding kinase beta
  • Myotonic dystrophy protein kinase-like beta
  • serine/threonine-protein kinase MRCK beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55964
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP2-01462
Species: Hu
Applications: WB, Flow, ICC/IF
NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
NBP1-84072
Species: Hu
Applications: IHC, IHC-P
NBP2-37474
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-82598
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81440
Species: Hu, Mu, Rt, Rt
Applications: WB, IHC, IHC-P

Publications for CDC42BPB Antibody (NBP1-81440) (0)

There are no publications for CDC42BPB Antibody (NBP1-81440).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42BPB Antibody (NBP1-81440) (0)

There are no reviews for CDC42BPB Antibody (NBP1-81440). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42BPB Antibody (NBP1-81440) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CDC42BPB Antibody (NBP1-81440)

Discover related pathways, diseases and genes to CDC42BPB Antibody (NBP1-81440). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CDC42BPB Antibody (NBP1-81440)

Discover more about diseases related to CDC42BPB Antibody (NBP1-81440).
 

Pathways for CDC42BPB Antibody (NBP1-81440)

View related products by pathway.

PTMs for CDC42BPB Antibody (NBP1-81440)

Learn more about PTMs related to CDC42BPB Antibody (NBP1-81440).
 

Research Areas for CDC42BPB Antibody (NBP1-81440)

Find related products by research area.

Blogs on CDC42BPB

There are no specific blogs for CDC42BPB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CDC42BPB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42BPB