MPZL1 Antibody - Azide and BSA Free

Western Blot: MPZL1 Antibody [NBP2-93845] - Analysis of extracts of various cell lines, using MPZL1 .Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MPZL1 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit MPZL1 Antibody - Azide and BSA Free (NBP2-93845) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 195-269 of human MPZL1 (NP_003944.1). NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPZL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MPZL1 Antibody - Azide and BSA Free

• FLJ21047
• immunoglobulin family transmembrane protein
• MPZL1b
• myelin protein zero-like 1
• myelin protein zero-like protein 1
• protein zero related
• Protein zero-related
• PZR1b
• PZRb
• PZRPZRa

Background

MPZL1, or Myelin protein zero-like protein 1, contains five isoforms that are 29 kDa, 28 kDa, 23 kDa, 16 kDa, and 12 kDa, and is involved in the process of signal transduction as a cell surface receptor. Research is currently being conducted on MPZL1 and its relation to a variety of diseases and disorders, including noonan syndrome, schizophrenia, essential hypertension, t-cell leukemia, tooth disease, and choroiditis. MPZL1 has been linked to the protein tyrosine kinase signaling pathway, and has been found to interact with PTPN11, SRC, EXOSC4, UBC, and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: MPZL1