SCN4A Antibody

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SCN4A Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SCN4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SCN4A Antibody

• HOKPP2
• HYKPP
• HYPP
• Na(V)1.4
• NAC1A
• Nav1.4
• skeletal muscle voltage-dependent sodium channel type IV alpha subunit
• SkM1
• sodium channel protein skeletal muscle subunit alpha
• sodium channel protein type 4 subunit alpha
• sodium channel protein type IV subunit alpha
• sodium channel, voltage-gated, type IV, alpha subunit
• voltage-gated sodium channel subunit alpha Nav1.4

Background

SCN4A is a member of the sodium channel alpha subunit family and mediates the voltage-dependent sodium ion permeability of excitable membranes. It assumes opened or closed conformations in response to the voltage difference across the membrane; the protein forms a sodium-selective channel through which Na(+) ions may pass in accordance with their electrochemical gradient. This sodium channel may be present in both denervated and innervated skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SCN4A
• Uniprot:
  • P35499(Human)