MPZL1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MPZL1 Antibody [NBP2-57487] - Staining of human cell line HaCaT shows localization to plasma membrane, cell junctions & vesicles.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MPZL1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MPZL1 Antibody - BSA Free (NBP2-57487) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPZL1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MPZL1 Recombinant Protein Antigen (NBP2-57487PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MPZL1 Antibody - BSA Free

• FLJ21047
• immunoglobulin family transmembrane protein
• MPZL1b
• myelin protein zero-like 1
• myelin protein zero-like protein 1
• protein zero related
• Protein zero-related
• PZR1b
• PZRb
• PZRPZRa

Background

MPZL1, or Myelin protein zero-like protein 1, contains five isoforms that are 29 kDa, 28 kDa, 23 kDa, 16 kDa, and 12 kDa, and is involved in the process of signal transduction as a cell surface receptor. Research is currently being conducted on MPZL1 and its relation to a variety of diseases and disorders, including noonan syndrome, schizophrenia, essential hypertension, t-cell leukemia, tooth disease, and choroiditis. MPZL1 has been linked to the protein tyrosine kinase signaling pathway, and has been found to interact with PTPN11, SRC, EXOSC4, UBC, and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MPZL1