MPHOSPH9- Antibody

Images

 
Immunohistochemistry-Paraffin: MPHOSPH9- Antibody [NBP1-87870] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPHOSPH9- Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YKSKDPKEFMEHIDVPKGQYVAPAVPAESLVDGVKNENFYIQTPEECHVSLKEDVSISPGEFEHNFLGENKVSEVYSGKTNSNAITSWAQKLKQNQPK
Specificity
Specificity of human MPHOSPH9- antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPHOSPH9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MPHOSPH9- Protein (NBP1-87870PEP)
Publications
Read Publication using NBP1-87870.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPHOSPH9- Antibody

  • FLJ12954
  • M-phase phosphoprotein 9
  • MPP-9
  • MPP9DKFZp434J034

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7270-IL/CF
Species: Hu
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
H00007757-R01
Species: Hu
NBP1-86834
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5126
Species: Hu, Mu, Rt
Applications: WB, ICC
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NB100-56737
Species: Hu
Applications: WB
AF7164
Species: Hu
Applications: WB
NBP2-66016
Species: Hu
NB200-193
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready, ICC
NB100-94995
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr, ICC
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for MPHOSPH9- Antibody (NBP1-87870)(1)

Reviews for MPHOSPH9- Antibody (NBP1-87870) (0)

There are no reviews for MPHOSPH9- Antibody (NBP1-87870). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MPHOSPH9- Antibody (NBP1-87870) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MPHOSPH9- Antibody (NBP1-87870)

Discover related pathways, diseases and genes to MPHOSPH9- Antibody (NBP1-87870). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPHOSPH9- Antibody (NBP1-87870)

Discover more about diseases related to MPHOSPH9- Antibody (NBP1-87870).
 

Pathways for MPHOSPH9- Antibody (NBP1-87870)

View related products by pathway.

Research Areas for MPHOSPH9- Antibody (NBP1-87870)

Find related products by research area.

Blogs on MPHOSPH9-

There are no specific blogs for MPHOSPH9-, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPHOSPH9- Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPHOSPH9