ZFP95 Antibody

Images

 
Western Blot: ZFP95 Antibody [NBP1-86834] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ZFP95 Antibody [NBP1-86834] - Staining of human cell line RH-30 shows localization to intermediate filaments.
Immunohistochemistry-Paraffin: ZFP95 Antibody [NBP1-86834] - Staining of human esophagus shows strong cytoplasmic and nuclear membrane positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZFP95 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCSPHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZKSCAN5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZFP95 Protein (NBP1-86834PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZFP95 Antibody

  • FLJ39233
  • KIAA1015
  • MGC33710
  • ZFP95
  • zfp-95
  • zinc finger protein 95 homolog (mouse)
  • Zinc finger protein 95 homolog
  • zinc finger protein homologous to Zfp95 in mouse
  • zinc finger protein with KRAB and SCAN domains 5
  • zinc finger with KRAB and SCAN domains 5
  • ZNF914

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88018
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80912
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33094
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87870
Species: Hu
Applications: IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP1-80824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00007757-R01
Species: Hu
H00003087-M02
Species: Hu
Applications: WB, ELISA
AF7164
Species: Hu
Applications: WB
MAB4069
Species: Hu, Mu, Rt
Applications: WB
AF6174
Species: Hu
Applications: WB, IHC, IP
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88851
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46578
Species: Hu
Applications: WB, IHC

Publications for ZFP95 Antibody (NBP1-86834) (0)

There are no publications for ZFP95 Antibody (NBP1-86834).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZFP95 Antibody (NBP1-86834) (0)

There are no reviews for ZFP95 Antibody (NBP1-86834). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZFP95 Antibody (NBP1-86834) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZFP95 Products

Bioinformatics Tool for ZFP95 Antibody (NBP1-86834)

Discover related pathways, diseases and genes to ZFP95 Antibody (NBP1-86834). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZFP95 Antibody (NBP1-86834)

Discover more about diseases related to ZFP95 Antibody (NBP1-86834).
 

Pathways for ZFP95 Antibody (NBP1-86834)

View related products by pathway.

Blogs on ZFP95

There are no specific blogs for ZFP95, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZFP95 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZKSCAN5