MPG1 Antibody

Images

 
Immunohistochemistry-Paraffin: MPG1 Antibody [NBP2-14246] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPG1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: EGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPVHLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASSQVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDY
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPEG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MPG1 Protein (NBP2-14246PEP)
Publications
Read Publication using NBP2-14246.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPG1 Antibody

  • macrophage expressed 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6028
Species: Hu
Applications: WB
NB100-563
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-07374
Species: Hu
Applications: Flow, ICC/IF, PA, WB
NBP1-32775
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
NBP2-85249
Species: Hu, Mu
Applications: WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
NBP1-88517
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP3-12270
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-86509
Species: Hu
Applications: IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-59828
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NB100-338
Species: Ha, Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NB100-56479
Species: Bv, Ca, Hu, Mu, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-19989
Species: Hu, Mu, Rt
Applications: WB
NB100-56507
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
NBP1-89951
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for MPG1 Antibody (NBP2-14246)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MPG1 Antibody (NBP2-14246) (0)

There are no reviews for MPG1 Antibody (NBP2-14246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MPG1 Antibody (NBP2-14246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPEG1