MPG1 Antibody

Images

 
Immunohistochemistry-Paraffin: MPG1 Antibody [NBP2-14246] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MPG1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EGKMTNFSFGGVYQECTQLSGNRDVLLCQKLEQKNPLTGDFSCPSGYSPV HLLSQIHEEGYNHLECHRKCTLLVFCKTVCEDVFQVAKAEFRAFWCVASS QVPENSGLLFGGLFSSKSINPMTNAQSCPAGYFPLRLFENLKVCVSQDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPEG1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MPG1 Protein (NBP2-14246PEP)
Publications
Read Publication using NBP2-14246.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MPG1 Antibody

  • macrophage expressed 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6028
Species: Hu
Applications: WB, IHC
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
AF4185
Species: Hu
Applications: ICC
NBP1-32775
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-88517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1116
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA
NB100-56507
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-89951
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MPG1 Antibody (NBP2-14246)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for MPG1 Antibody (NBP2-14246) (0)

There are no reviews for MPG1 Antibody (NBP2-14246). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MPG1 Antibody (NBP2-14246) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPG1 Products

Bioinformatics Tool for MPG1 Antibody (NBP2-14246)

Discover related pathways, diseases and genes to MPG1 Antibody (NBP2-14246). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPG1 Antibody (NBP2-14246)

Discover more about diseases related to MPG1 Antibody (NBP2-14246).
 

Pathways for MPG1 Antibody (NBP2-14246)

View related products by pathway.

PTMs for MPG1 Antibody (NBP2-14246)

Learn more about PTMs related to MPG1 Antibody (NBP2-14246).

Blogs on MPG1

There are no specific blogs for MPG1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPG1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MPEG1