MPG Recombinant Protein Antigen

Images

 
There are currently no images for MPG Protein (NBP1-82787PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MPG Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MPG.

Source: E.coli

Amino Acid Sequence: YFCMNISSQGDGACVLLRALEPLEGLETMRQLRSTLRKGTASRVLKDRELCSGPSKLCQALAINKSFDQRDLAQDEAVWLERGPLEPSEPAVVAAARVGVGHAGEWARKPLRFYVRGS

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MPG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-82787.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MPG Recombinant Protein Antigen

  • 3' end of the Mid1 gene, localized 68 kb upstream the humanzeta globin gene on16p
  • 3-alkyladenine DNA glycosylase
  • 3-methyladenine DNA glycosidase
  • AAG
  • ADPG
  • anpg
  • APNG
  • CRA36.1 (3-methyl-adenine DNA glycosylase)
  • CRA36.1
  • DNA-3-methyladenine glycosylase
  • EC 3.2.2.21
  • MDGalkyladenine DNA glycosylase
  • Mid1
  • N-methylpurine-DNA glycosylase, MPG
  • N-methylpurine-DNA glycosylasePIG16
  • PIG11
  • proliferation-inducing protein 11
  • proliferation-inducing protein 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-116
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-16182
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
H00005018-D01P
Species: Hu
Applications: WB, ICC/IF
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-106
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-82787PEP
Species: Hu
Applications: AC

Publications for MPG Protein (NBP1-82787PEP) (0)

There are no publications for MPG Protein (NBP1-82787PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPG Protein (NBP1-82787PEP) (0)

There are no reviews for MPG Protein (NBP1-82787PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MPG Protein (NBP1-82787PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MPG Products

Bioinformatics Tool for MPG Protein (NBP1-82787PEP)

Discover related pathways, diseases and genes to MPG Protein (NBP1-82787PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPG Protein (NBP1-82787PEP)

Discover more about diseases related to MPG Protein (NBP1-82787PEP).
 

Pathways for MPG Protein (NBP1-82787PEP)

View related products by pathway.

PTMs for MPG Protein (NBP1-82787PEP)

Learn more about PTMs related to MPG Protein (NBP1-82787PEP).

Blogs on MPG

There are no specific blogs for MPG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MPG Antibody
NBP1-82787
OGG1 Antibody
NB100-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MPG Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MPG