MON2 Antibody


Western Blot: MON2 Antibody [NBP2-83219] - WB Suggested Anti-MON2 Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal Kidney

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

MON2 Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of Human MON2. Peptide sequence: SVAFHCLLDLVRGITSMIEGELGELETECQTTTEEGSSPTQSTEQQDLQS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for MON2 Antibody

  • MON2 homolog (S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, CyTOF-ready, Dual ISH-IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC, KD
Species: Hu
Applications: IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MON2 Antibody (NBP2-83219) (0)

There are no publications for MON2 Antibody (NBP2-83219).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MON2 Antibody (NBP2-83219) (0)

There are no reviews for MON2 Antibody (NBP2-83219). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MON2 Antibody (NBP2-83219) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MON2 Products

Array NBP2-83219

Bioinformatics Tool for MON2 Antibody (NBP2-83219)

Discover related pathways, diseases and genes to MON2 Antibody (NBP2-83219). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MON2 Antibody (NBP2-83219)

Discover more about diseases related to MON2 Antibody (NBP2-83219).

Pathways for MON2 Antibody (NBP2-83219)

View related products by pathway.

PTMs for MON2 Antibody (NBP2-83219)

Learn more about PTMs related to MON2 Antibody (NBP2-83219).

Blogs on MON2

There are no specific blogs for MON2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MON2 Antibody and receive a gift card or discount.


Gene Symbol MON2