MMS19 like protein Antibody


Immunocytochemistry/ Immunofluorescence: MMS19 like protein Antibody [NBP2-55388] - Staining of human cell line MCF7 shows localization to nucleoplasm.

Product Details

Reactivity Hu, MuSpecies Glossary
Applications ICC/IF

Order Details

MMS19 like protein Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA
Specificity of human MMS19 like protein antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MMS19 like protein Recombinant Protein Antigen (NBP2-55388PEP)

Reactivity Notes

Rat 88%

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MMS19 like protein Antibody

  • FLJ34167
  • MET18 homolog
  • MET18
  • MMS19 nucleotide excision repair homolog (S. cerevisiae)
  • S. cerevisiae)


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP
Species: Hu, Mu, V-Vi
Applications: WB, ChIP, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, Neut
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MMS19 like protein Antibody (NBP2-55388) (0)

There are no publications for MMS19 like protein Antibody (NBP2-55388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMS19 like protein Antibody (NBP2-55388) (0)

There are no reviews for MMS19 like protein Antibody (NBP2-55388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MMS19 like protein Antibody (NBP2-55388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MMS19 like protein Products

Bioinformatics Tool for MMS19 like protein Antibody (NBP2-55388)

Discover related pathways, diseases and genes to MMS19 like protein Antibody (NBP2-55388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMS19 like protein Antibody (NBP2-55388)

Discover more about diseases related to MMS19 like protein Antibody (NBP2-55388).

Pathways for MMS19 like protein Antibody (NBP2-55388)

View related products by pathway.

PTMs for MMS19 like protein Antibody (NBP2-55388)

Learn more about PTMs related to MMS19 like protein Antibody (NBP2-55388).

Blogs on MMS19 like protein

There are no specific blogs for MMS19 like protein, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MMS19 like protein Antibody and receive a gift card or discount.


Gene Symbol MMS19