CIAO1 Antibody

Images

 
Western Blot: CIAO1 Antibody [NBP1-84474] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: CIAO1 Antibody [NBP1-84474] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: CIAO1 Antibody [NBP1-84474] - Staining of human oral mucosa shows nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CIAO1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CSDDRTVRIWRQYLPGNEQGVACSGSDPSWKCICTLSGFHSRTIYDIAWCQLTGALATACGDDAIRVFQEDPNSDPQQPTFSLTAHLHQAHSQDVNCVAWNPKEPGLLASCSDDGEVAFWKYQR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CIAO1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CIAO1 Protein (NBP1-84474PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CIAO1 Antibody

  • CIA1
  • cytosolic iron-sulfur protein assembly 1 homolog (S. cerevisiae)
  • cytosolic iron-sulfur protein assembly 1
  • probable cytosolic iron-sulfur protein assembly protein CIAO1
  • WD repeat domain 39
  • WD repeat-containing protein 39
  • WD40 protein Ciao1
  • WDR39cytosolic iron-sulfur protein assembly 1 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-47371
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88092
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
AF3296
Species: Hu, Mu, Rt
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP2-02056
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-56087
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-57608
Species: Hu
Applications: WB, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87338
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83611
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83077
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NB500-207
Species: Hu
Applications: WB, ICC/IF, IP
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
AF3795
Species: Hu
Applications: WB, IP
NBP1-84474
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CIAO1 Antibody (NBP1-84474) (0)

There are no publications for CIAO1 Antibody (NBP1-84474).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CIAO1 Antibody (NBP1-84474) (0)

There are no reviews for CIAO1 Antibody (NBP1-84474). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CIAO1 Antibody (NBP1-84474) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CIAO1 Products

Bioinformatics Tool for CIAO1 Antibody (NBP1-84474)

Discover related pathways, diseases and genes to CIAO1 Antibody (NBP1-84474). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CIAO1 Antibody (NBP1-84474)

Discover more about diseases related to CIAO1 Antibody (NBP1-84474).
 

Pathways for CIAO1 Antibody (NBP1-84474)

View related products by pathway.

PTMs for CIAO1 Antibody (NBP1-84474)

Learn more about PTMs related to CIAO1 Antibody (NBP1-84474).
 

Research Areas for CIAO1 Antibody (NBP1-84474)

Find related products by research area.

Blogs on CIAO1

There are no specific blogs for CIAO1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CIAO1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CIAO1