MMP-9 Antibody

Images

 
Western Blot: MMP-9 Antibody [NBP1-85575] - Analysis in control (vector only transfected HEK293T lysate) and mMP9 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: MMP-9 Antibody [NBP1-85575] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: MMP-9 Antibody [NBP1-85575] - Staining of human spleen shows strong positivity in the red pulp.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP-9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADI
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MMP-9 Protein (NBP1-85575PEP)
Publications
Read Publications using
NBP1-85575 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (80%). Human reactivity reported in scientific literature (PMID: 23897811).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MMP-9 Antibody

  • 92 kDa gelatinase
  • 92 kDa type IV collagenase
  • CLG4B
  • EC 3.4.24
  • EC 3.4.24.35
  • Gelatinase B
  • GELB
  • macrophage gelatinase
  • MANDP2
  • matrix metallopeptidase 9
  • matrix metalloproteinase 9
  • matrix metalloproteinase-9
  • MMP9
  • MMP-9
  • type V collagenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF

Publications for MMP-9 Antibody (NBP1-85575)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for MMP-9 Antibody (NBP1-85575) (0)

There are no reviews for MMP-9 Antibody (NBP1-85575). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MMP-9 Antibody (NBP1-85575) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-9 Products

Bioinformatics Tool for MMP-9 Antibody (NBP1-85575)

Discover related pathways, diseases and genes to MMP-9 Antibody (NBP1-85575). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-9 Antibody (NBP1-85575)

Discover more about diseases related to MMP-9 Antibody (NBP1-85575).
 

Pathways for MMP-9 Antibody (NBP1-85575)

View related products by pathway.

PTMs for MMP-9 Antibody (NBP1-85575)

Learn more about PTMs related to MMP-9 Antibody (NBP1-85575).
 

Research Areas for MMP-9 Antibody (NBP1-85575)

Find related products by research area.

Blogs on MMP-9.

Cytokeratin 18 - A Intermediate Filament Cyotskeletal Component
Keratins, also called cytokeratins, are a family of filamentous structural proteins that form the intermediate filaments within epithelial cells. Keratins are differentially expressed depending on both the epithelial cell origin and degree of differen...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP9
Entrez