MLXIP Antibody

Images

 
Immunohistochemistry: MLXIP Antibody [NBP1-88617] - Staining of human skeletal muscle shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLXIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNVAALKNRQMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLXIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
MLXIP Protein (NBP1-88617PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MLXIP Antibody

  • bHLHe36BHLHE36
  • Class E basic helix-loop-helix protein 36
  • KIAA0867MondoA
  • MIRMLX-interacting protein
  • MLX interacting protein
  • MONDOAMlx interactor
  • Transcriptional activator MondoA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
AF4186
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-88617
Species: Hu
Applications: IHC, IHC-P

Publications for MLXIP Antibody (NBP1-88617) (0)

There are no publications for MLXIP Antibody (NBP1-88617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLXIP Antibody (NBP1-88617) (0)

There are no reviews for MLXIP Antibody (NBP1-88617). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MLXIP Antibody (NBP1-88617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLXIP Antibody Products

MLXIP NBP1-88617

Related Products by Gene

Bioinformatics Tool for MLXIP Antibody (NBP1-88617)

Discover related pathways, diseases and genes to MLXIP Antibody (NBP1-88617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLXIP Antibody (NBP1-88617)

Discover more about diseases related to MLXIP Antibody (NBP1-88617).
 

Pathways for MLXIP Antibody (NBP1-88617)

View related products by pathway.

Blogs on MLXIP

There are no specific blogs for MLXIP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLXIP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLXIP

Customers Who Bought This Also Bought