MLXIP Antibody

Images

 
Immunohistochemistry: MLXIP Antibody [NBP1-88617] - Staining of human skeletal muscle shows strong cytoplasmic positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

MLXIP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LKREGMLASTVSQSNVVIAPAAIARAPGVPEFHSSILVTDLGHGTSSPPAPVSRLFPSTAQDPLGKGEQVPLHGGSPQVTVTGPSRDCPNSGQASPCASEQSPSPQSPQNNCSGKSDPKNVAALKNRQMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MLXIP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
MLXIP Protein (NBP1-88617PEP)

Alternate Names for MLXIP Antibody

  • bHLHe36BHLHE36
  • Class E basic helix-loop-helix protein 36
  • KIAA0867MondoA
  • MIRMLX-interacting protein
  • MLX interacting protein
  • MONDOAMlx interactor
  • Transcriptional activator MondoA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24509
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, IHC-P
AF1034
Species: Mu
Applications: WB, Simple Western, IHC
NB100-308
Species: Hu
Applications: WB, Func, ICC/IF, IP
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56585
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54578
Species: Hu, Mu, Rt
Applications: WB, IHC-P, IP, PLA
NBP2-45867
Species: Hu
Applications: WB, Flow, IHC
AF4186
Species: Hu
Applications: WB, ICC
NBP1-32870
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-60106
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-88617
Species: Hu
Applications: IHC, IHC-P

Publications for MLXIP Antibody (NBP1-88617) (0)

There are no publications for MLXIP Antibody (NBP1-88617).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLXIP Antibody (NBP1-88617) (0)

There are no reviews for MLXIP Antibody (NBP1-88617). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MLXIP Antibody (NBP1-88617) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLXIP Antibody Products

MLXIP NBP1-88617

Related Products by Gene

Bioinformatics Tool for MLXIP Antibody (NBP1-88617)

Discover related pathways, diseases and genes to MLXIP Antibody (NBP1-88617). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLXIP Antibody (NBP1-88617)

Discover more about diseases related to MLXIP Antibody (NBP1-88617).
 

Pathways for MLXIP Antibody (NBP1-88617)

View related products by pathway.

Blogs on MLXIP

There are no specific blogs for MLXIP, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MLXIP

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88617 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought