MLX Antibody

Images

 
Western Blot: MLX Antibody [H00006945-B02P] - Analysis of MLX expression in transfected 293T cell line by MLX polyclonal antibody. Lane 1: MLX transfected lysate(23.54 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MLX Antibody Summary

Immunogen
MLX (NP_937848.1, 1 a.a. - 214 a.a.) full-length human protein. MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY
Specificity
MLX - MAX-like protein X,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MLX
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MLX Antibody

  • BHLHD13
  • bHLHd13Max-like bHLHZip protein
  • BigMax alpha
  • BigMax protein
  • Class D basic helix-loop-helix protein 13
  • MAD7
  • MAX-like protein X
  • MLX
  • MXD7
  • TCFL4
  • TCFL4Protein BigMax
  • transcription factor-like 4
  • Transcription factor-like protein 4

Background

The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP1-33596
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89680
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
PP-H8132-00
Species: Hu
Applications: WB, IHC, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NB400-135
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
PP-H7147-00
Species: Hu
Applications: WB, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-610
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46522
Species: Hu
Applications: WB, IHC
NBP2-27079
Species: Hu, Ca, Pm
Applications: WB, IHC-P
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for MLX Antibody (H00006945-B02P) (0)

There are no publications for MLX Antibody (H00006945-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLX Antibody (H00006945-B02P) (0)

There are no reviews for MLX Antibody (H00006945-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MLX Antibody (H00006945-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MLX Products

Bioinformatics Tool for MLX Antibody (H00006945-B02P)

Discover related pathways, diseases and genes to MLX Antibody (H00006945-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLX Antibody (H00006945-B02P)

Discover more about diseases related to MLX Antibody (H00006945-B02P).
 

Pathways for MLX Antibody (H00006945-B02P)

View related products by pathway.

PTMs for MLX Antibody (H00006945-B02P)

Learn more about PTMs related to MLX Antibody (H00006945-B02P).

Blogs on MLX.

ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer
ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MLX
Entrez
Uniprot