MLL3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MLL3 Antibody [NBP2-57730] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MLL3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ
Specificity
Specificity of human MLL3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KMT2C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control
MLL3 Knockout HeLa Cell Lysate
Control Peptide
MLL3 Recombinant Protein Antigen (NBP2-57730PEP)

Reactivity Notes

Mouse 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MLL3 Antibody

  • ALR-like protein
  • DKFZp686C08112
  • EC 2.1.1.43
  • FLJ12625
  • HALRMGC119851
  • histone-lysine N-methyltransferase MLL3
  • histone-lysine N-methyltransferase, H3 lysine-4 specific
  • Homologous to ALR protein
  • KIAA1506FLJ38309
  • KMT2C
  • KMT2CMGC119852
  • Lysine N-methyltransferase 2C
  • MGC119853
  • myeloid/lymphoid or mixed-lineage leukemia 3
  • Myeloid/lymphoid or mixed-lineage leukemia protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89123
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-864
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-33877
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
MAB7940
Species: Hu
Applications: WB, IHC
NB600-252
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, CHIP-SEQ
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80628
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-215
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
H00001059-B01P
Species: Hu
Applications: WB, ICC/IF
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NBP2-57730
Species: Hu
Applications: ICC/IF

Publications for MLL3 Antibody (NBP2-57730) (0)

There are no publications for MLL3 Antibody (NBP2-57730).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLL3 Antibody (NBP2-57730) (0)

There are no reviews for MLL3 Antibody (NBP2-57730). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MLL3 Antibody (NBP2-57730) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MLL3 Products

Array NBP2-57730

Bioinformatics Tool for MLL3 Antibody (NBP2-57730)

Discover related pathways, diseases and genes to MLL3 Antibody (NBP2-57730). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MLL3 Antibody (NBP2-57730)

Discover more about diseases related to MLL3 Antibody (NBP2-57730).
 

Pathways for MLL3 Antibody (NBP2-57730)

View related products by pathway.

PTMs for MLL3 Antibody (NBP2-57730)

Learn more about PTMs related to MLL3 Antibody (NBP2-57730).

Blogs on MLL3

There are no specific blogs for MLL3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MLL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KMT2C