MLK2 Antibody - BSA Free

Western Blot: MLK2 Antibody [NBP2-85296] - WB Suggested Anti-MAP3K10 Antibody. Titration: 1.0 ug/ml. Positive Control: THP-1 Whole Cell

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MLK2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MLK2 Antibody - BSA Free (NBP2-85296) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MLK2. Peptide sequence: TLTFAPRPRPAASRPRLDPWKLVSFGRTLTISPPSRPDTPESPGPPSVQP The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP3K10
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MLK2 Antibody - BSA Free

• EC 2.7.11
• MAP3K10
• MEKK10
• mitogen-activated protein kinase kinase kinase 10
• Mixed lineage kinase 2
• MKN28 kinase
• MLK2
• MLK2MKN28 derived nonreceptor_type serine/threonine kinase
• MST
• MSTEC 2.7.11.25
• Protein kinase MST

Background

MLK2, also known as Mitogen-Activated Protein Kinase Kinase Kinase 10, is involved in the induction of apoptosis and the neuronal death mechanism. MLK2 is known to have interactions with ABL2, CLTC, CNKSR1, HTT and KIAA1804. MLK2 has been studied in relation to Alexander disease, Huntington's disease, Parkinson's disease, neuroblastoma, neuronitis, breast carcinoma, and immunodeficiency.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAP3K10