MLF1 Interacting Protein Recombinant Protein Antigen

Images

 
There are currently no images for MLF1 Interacting Protein Protein (NBP1-85689PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MLF1 Interacting Protein Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MLF1IP.

Source: E. coli

Amino Acid Sequence: EETYETFDPPLHSTAIYADEEEFSKHCGLSLSSTPPGKEAKRSSDTSGNEASEIESVKISAKKPGRKLRPISDDSESIEESDTRRKVKSAEKISTQRHEVIRTTASSELSEKPAESV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CENPU
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85689.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MLF1 Interacting Protein Recombinant Protein Antigen

  • CENP-50
  • CENP-U
  • CENPU50
  • CENPUMLF1-interacting protein
  • centromere protein of 50 kDa
  • centromere protein U
  • FLJ23468
  • ICEN24
  • Interphase centromere complex protein 24
  • KLIP1CENP50
  • KSHV latent nuclear antigen interacting protein 1
  • KSHV latent nuclear antigen-interacting protein 1
  • MLF1 interacting protein
  • PBIP1
  • Polo-box-interacting protein 1

Background

Myeloid leukemia factor-1 (MLF1) Interacting Protein (also known as PBIP1, MLF1IP1, KLIP1 or KSHV latent nuclear antigen interacting protein 1) is a novel polo-like kinase 1 (Plk1) substrate. Plk1 phosphorylation of MLF1IP induces ubiquitination and degradation of MLF1IP prior to the metaphase/ anaphase transition. Several Plk1-dependent phosphorylation sites have been identified on MLF1IP by mass spectrometry. Mutations of these sites stabilize MLF1IP and inhibit mitotic progression. Subsequent in vitro and in vivo MLF1IP phosphorylation and stability assays have revealed that phosphorylation of Thr78 is critical for triggering Plk1-dependent MLF1IP degradation. Expression of a non-degradable Thr78Ala mutant was sufficient to induce a mitotic block. Timely phosphorylation of MLF1IP on Thr78 by Plk1 is critical for eliminating the MLF1IP-imposed mitotic block prior to anaphase onset. MLF1IP is speculated to be a novel tumor suppressor, whose function is required for proper sister-chromatid separation. Loss of MLF1IP function may result in improper segregation of chromosomes and genomic instability, thus promoting tumorigenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-48291
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-02052
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-47844
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP1-89827
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-47291
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-269
Species: Bv, Ce, Ch, Dr, Eq, Hu, Mu, Pl, Po, Rt, Y, Ye
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KD, WB
5096-BM
Species: Hu
Applications: BA
739-G9
Species: Mu
Applications: BA
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-55216
Species: Hu
Applications: WB
NB100-338
Species: Ha, Hu, Mar, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
MAB1259
Species: Hu
Applications: CyTOF-reported, ICC, ICFlow
NBP1-85435
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-294
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, MiAr, WB
NBP1-82546
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85689PEP
Species: Hu
Applications: AC

Publications for MLF1 Interacting Protein Protein (NBP1-85689PEP) (0)

There are no publications for MLF1 Interacting Protein Protein (NBP1-85689PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MLF1 Interacting Protein Protein (NBP1-85689PEP) (0)

There are no reviews for MLF1 Interacting Protein Protein (NBP1-85689PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MLF1 Interacting Protein Protein (NBP1-85689PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MLF1 Interacting Protein Products

Research Areas for MLF1 Interacting Protein Protein (NBP1-85689PEP)

Find related products by research area.

Blogs on MLF1 Interacting Protein

There are no specific blogs for MLF1 Interacting Protein, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MLF1 Interacting Protein Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPU