CENPQ Antibody

Images

 
Western Blot: CENPQ Antibody [NBP1-55216] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Western Blot: CENPQ Antibody [NBP1-55216] - Human Liver cell lysate, concentration 0.2-1 ug/ml.
Western Blot: CENPQ Antibody [NBP1-55216] - Human 293T, Antibody Dilution: 1.0 ug/ml CENPQ is supported by BioGPS gene expression data to be expressed in HEK293T.
Western Blot: CENPQ Antibody [NBP1-55216] - Human 721_B, Antibody Dilution: 1.0 ug/ml CENPQ is supported by BioGPS gene expression data to be expressed in 721_B.
Western Blot: CENPQ Antibody [NBP1-55216] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Western Blot: CENPQ Antibody [NBP1-55216] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CENPQ Antibody Summary

Immunogen
Synthetic peptides corresponding to CENPQ(centromere protein Q) The peptide sequence was selected from the N terminal of CENPQ. Peptide sequence VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CENPQ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CENPQ and was validated on Western blot.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CENPQ Antibody

  • C6orf139
  • CENP-QFLJ10545
  • centromere protein Q
  • chromosome 6 open reading frame 139

Background

CENPQ is a subunit of a CENPH (MIM 605607)-CENPI (MIM 300065)-associated centromeric complex that targets CENPA (MIM 117139) to centromeres and is required for proper kinetochore function and mitotic progression (Okada et al., 2006 [PubMed 16622420]).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79664
Species: Hu
Applications: WB, ICC/IF
NBP1-88485
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85688
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76240
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-34093
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
H00064105-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00378708-B01P
Species: Hu
Applications: WB, ELISA
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-77938
Species: Hu, Bv, Ca, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00079019-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP2-55474
Species: Hu
Applications: ICC/IF
NBP1-85687
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38854
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-55216
Species: Hu
Applications: WB

Publications for CENPQ Antibody (NBP1-55216) (0)

There are no publications for CENPQ Antibody (NBP1-55216).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CENPQ Antibody (NBP1-55216) (0)

There are no reviews for CENPQ Antibody (NBP1-55216). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CENPQ Antibody (NBP1-55216) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CENPQ Products

Bioinformatics Tool for CENPQ Antibody (NBP1-55216)

Discover related pathways, diseases and genes to CENPQ Antibody (NBP1-55216). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CENPQ

There are no specific blogs for CENPQ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CENPQ Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CENPQ
Uniprot