MKK7/MEK7 Antibody

Images

 
Immunohistochemistry: MKK7/MEK7 Antibody [NBP1-87792] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MKK7/MEK7 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETMEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAP2K7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MKK7/MEK7 Protein (NBP1-87792PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MKK7/MEK7 Antibody

  • c-Jun N-terminal kinase kinase 2
  • dual specificity mitogen-activated protein kinase kinase 7
  • EC 2.7.12.2
  • JNK kinase 2
  • JNK-activating kinase 2
  • JNKK 2
  • JNKK2
  • MAP kinase kinase 7
  • MAP2K7
  • MAPK/ERK kinase 7
  • MAPKK7
  • MEK 7
  • MEK7
  • mitogen-activated protein kinase kinase 7
  • MKE7
  • MKK7
  • MKK7MAPKK 7
  • PRKMK7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB1846
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-68874
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
NBP1-88419
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82050
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-00764
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-81575
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47833
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-44405
Species: Hu
Applications: Flow, IHC-P, IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for MKK7/MEK7 Antibody (NBP1-87792) (0)

There are no publications for MKK7/MEK7 Antibody (NBP1-87792).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKK7/MEK7 Antibody (NBP1-87792) (0)

There are no reviews for MKK7/MEK7 Antibody (NBP1-87792). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MKK7/MEK7 Antibody (NBP1-87792) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MKK7/MEK7 Products

Bioinformatics Tool for MKK7/MEK7 Antibody (NBP1-87792)

Discover related pathways, diseases and genes to MKK7/MEK7 Antibody (NBP1-87792). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKK7/MEK7 Antibody (NBP1-87792)

Discover more about diseases related to MKK7/MEK7 Antibody (NBP1-87792).
 

Pathways for MKK7/MEK7 Antibody (NBP1-87792)

View related products by pathway.

PTMs for MKK7/MEK7 Antibody (NBP1-87792)

Learn more about PTMs related to MKK7/MEK7 Antibody (NBP1-87792).
 

Research Areas for MKK7/MEK7 Antibody (NBP1-87792)

Find related products by research area.

Blogs on MKK7/MEK7

There are no specific blogs for MKK7/MEK7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKK7/MEK7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAP2K7
Entrez