MKK6/MEK6 Antibody


Western Blot: MKK6/MEK6 Antibody [NBP1-87791] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: MKK6/MEK6 Antibody [NBP1-87791] - Staining of human cell line A549 shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: MKK6/MEK6 Antibody [NBP1-87791] - Staining in human colon and testis tissues using anti-MAP2K6 antibody. Corresponding MAP2K6 RNA-seq data are presented for the same tissues.
Western Blot: MKK6/MEK6 Antibody [NBP1-87791] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-341
Immunohistochemistry-Paraffin: MKK6/MEK6 Antibody [NBP1-87791] - Staining of human colon shows high expression.
Immunohistochemistry-Paraffin: MKK6/MEK6 Antibody [NBP1-87791] - Staining of human testis shows low expression as expected.

Product Details

Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MKK6/MEK6 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGR
Specificity of human, mouse, rat MKK6/MEK6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MKK6/MEK6 Protein (NBP1-87791PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MKK6/MEK6 Antibody

  • MAP kinase kinase 6
  • MAP2K6
  • MAPK/ERK kinase 6
  • MAPKK6dual specificity mitogen-activated protein kinase kinase 6
  • MEK6
  • mitogen-activated protein kinase kinase 6
  • MKK6
  • MKK6MEK 6
  • PRKMK6
  • PRKMK6protein kinase, mitogen-activated, kinase 6 (MAP kinase kinase 6)
  • SAPKK3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MKK6/MEK6 Antibody (NBP1-87791) (0)

There are no publications for MKK6/MEK6 Antibody (NBP1-87791).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKK6/MEK6 Antibody (NBP1-87791) (0)

There are no reviews for MKK6/MEK6 Antibody (NBP1-87791). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MKK6/MEK6 Antibody (NBP1-87791) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MKK6/MEK6 Products

Bioinformatics Tool for MKK6/MEK6 Antibody (NBP1-87791)

Discover related pathways, diseases and genes to MKK6/MEK6 Antibody (NBP1-87791). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKK6/MEK6 Antibody (NBP1-87791)

Discover more about diseases related to MKK6/MEK6 Antibody (NBP1-87791).

Pathways for MKK6/MEK6 Antibody (NBP1-87791)

View related products by pathway.

PTMs for MKK6/MEK6 Antibody (NBP1-87791)

Learn more about PTMs related to MKK6/MEK6 Antibody (NBP1-87791).

Research Areas for MKK6/MEK6 Antibody (NBP1-87791)

Find related products by research area.

Blogs on MKK6/MEK6

There are no specific blogs for MKK6/MEK6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MKK6/MEK6 Antibody and receive a gift card or discount.


Gene Symbol MAP2K6