MKK4/MEK4 Antibody - BSA Free

Western Blot: MKK4/MEK4 Antibody [NBP3-03652] - Analysis of extracts of various cell lines, using MKK4/MEK4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.

Western Blot: MKK4/MEK4 Antibody [NBP3-03652] - Analysis of extracts from normal (control) and MAP2K4 knockout (KO) HeLa cells, using MKK4/MEK4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Rat ovary using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of lysates from A-549 cells, using MKK4/MEK4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Human colon cancer using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Rat lung using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of various lysates, using MKK4/MEK4 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunohistochemistry: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MKK4/MEK4 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MKK4/MEK4 Antibody - BSA Free [MKK4/MEK4] - Western blot analysis of lysates from HeLa cells, using MKK4/MEK4 Rabbit pAb at 1:700 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MKK4/MEK4 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit MKK4/MEK4 Antibody - BSA Free (NBP3-03652) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-399 of human MKK4/MEK4 (NP_003001.1). LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MAP2K4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MKK4/MEK4 Antibody - BSA Free

• c-Jun N-terminal kinase kinase 1
• dual specificity mitogen-activated protein kinase kinase 4
• JNK activating kinase 1
• JNK-activated kinase 1
• JNK-activating kinase 1
• JNKK
• JNKK1
• JNKK1MAPK/ERK kinase 4
• MAP kinase kinase 4
• MAP2K4
• MAPKK4
• MEK4
• MEK4MEK 4
• mitogen-activated protein kinase kinase 4
• MKK4
• MKK4SAPK/ERK kinase 1
• PRKMK4
• PRKMK4MAPKK 4
• SEK1
• SERK1
• SERK1EC 2.7.12.2

Background

MKK4, also known as JNKK1 and SEK1, is a dual specificity kinase that belongs to the Ser/Thr protein kinase family. MKK4 is a direct activator of MAP kinases in response to various environmental stresses or mitogenic stimuli. MKK4 phosphorylates and activates p38 MAP kinase and JNK but not ERK 1/2 (1-2). JNK is activated by dual phosphorylation at Thr and Tyr by MKK4 and MKK7; although MKK4 will preferentially phosphorylate Tyr (3). MKK4 is also known to be a tumor suppressor, as mutations inactivating the MKK4 gene have been found in 5% of a wide variety of tumor types (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MAP2K4