MIOX Antibody


Western Blot: MIOX Antibody [NBP2-31976] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: MIOX Antibody [NBP2-31976] - Staining in human kidney and pancreas tissues using anti-MIOX antibody. Corresponding MIOX RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: MIOX Antibody [NBP2-31976] - Staining of human kidney shows high expression.
Immunohistochemistry-Paraffin: MIOX Antibody [NBP2-31976] - Staining of human pancreas shows low expression as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MIOX Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: QWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLDRVLMSWGHDEYMYQVMKFNKFSL
Specificity of human MIOX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MIOX Protein (NBP2-31976PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MIOX Antibody

  • aldehyde reductase (aldose reductase) like 6
  • Aldehyde reductase-like 6
  • ALDRL6
  • inositol oxygenase
  • Kidney-specific protein 32
  • KSP32
  • MGC90217
  • MI oxygenase
  • myo-inositol oxygenaseEC
  • Renal-specific oxidoreductase
  • RSOR


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Bv, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for MIOX Antibody (NBP2-31976) (0)

There are no publications for MIOX Antibody (NBP2-31976).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIOX Antibody (NBP2-31976) (0)

There are no reviews for MIOX Antibody (NBP2-31976). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MIOX Antibody (NBP2-31976) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MIOX Products

Bioinformatics Tool for MIOX Antibody (NBP2-31976)

Discover related pathways, diseases and genes to MIOX Antibody (NBP2-31976). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIOX Antibody (NBP2-31976)

Discover more about diseases related to MIOX Antibody (NBP2-31976).

Pathways for MIOX Antibody (NBP2-31976)

View related products by pathway.

PTMs for MIOX Antibody (NBP2-31976)

Learn more about PTMs related to MIOX Antibody (NBP2-31976).

Blogs on MIOX

There are no specific blogs for MIOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MIOX Antibody and receive a gift card or discount.


Gene Symbol MIOX