Mindin/Spondin-2 Antibody - BSA Free Summary
| Description |
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen |
Synthetic peptides corresponding to SPON2(spondin 2, extracellular matrix protein) The peptide sequence was selected from the N terminal of SPON2.
Peptide sequence CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SPON2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for Mindin/Spondin-2 Antibody - BSA Free
Background
SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, WB
Species: Hu, Ma, Mu, Po, Rt
Applications: Flow, ICC/IF, IP, KD, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Bind
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Fe, Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, IHC, Neut
Species: Hu, Mu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Mu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Publications for Mindin/Spondin-2 Antibody (NBP1-59176) (0)
There are no publications for Mindin/Spondin-2 Antibody (NBP1-59176).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Mindin/Spondin-2 Antibody (NBP1-59176) (0)
There are no reviews for Mindin/Spondin-2 Antibody (NBP1-59176).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Mindin/Spondin-2 Antibody (NBP1-59176) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Mindin/Spondin-2 Products
Blogs on Mindin/Spondin-2