MID1IP1 Antibody


Western Blot: MID1IP1 Antibody [NBP1-84629] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: MID1IP1 Antibody [NBP1-84629] - Staining of human small intestine shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

MID1IP1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: CLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGA
Specificity of human MID1IP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MID1IP1 Protein (NBP1-84629PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MID1IP1 Antibody

  • FLJ10386
  • G12-like
  • Gastrulation-specific G12-like protein
  • MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish))
  • MID1 interacting protein 1 (gastrulation specific G12-like (zebrafish))
  • MID1 interacting protein 1 (gastrulation specific G12-like)
  • Mid1-interacting G12-like protein
  • mid1-interacting protein 1
  • MIG12MID1 interacting G12-like protein
  • Protein STRAIT11499
  • S14R
  • Spot 14-R
  • Spot 14-related protein
  • STRAIT11499


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ChIP, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
Species: Hu, Fe, Pm
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MID1IP1 Antibody (NBP1-84629) (0)

There are no publications for MID1IP1 Antibody (NBP1-84629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MID1IP1 Antibody (NBP1-84629) (0)

There are no reviews for MID1IP1 Antibody (NBP1-84629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MID1IP1 Antibody (NBP1-84629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MID1IP1 Products

Bioinformatics Tool for MID1IP1 Antibody (NBP1-84629)

Discover related pathways, diseases and genes to MID1IP1 Antibody (NBP1-84629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MID1IP1 Antibody (NBP1-84629)

Discover more about diseases related to MID1IP1 Antibody (NBP1-84629).

Pathways for MID1IP1 Antibody (NBP1-84629)

View related products by pathway.

Research Areas for MID1IP1 Antibody (NBP1-84629)

Find related products by research area.

Blogs on MID1IP1

There are no specific blogs for MID1IP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MID1IP1 Antibody and receive a gift card or discount.


Gene Symbol MID1IP1