Microsomal Glutathione S-transferase 1 Recombinant Protein Antigen

Images

 
There are currently no images for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Microsomal Glutathione S-transferase 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MGST1.

Source: E. coli

Amino Acid Sequence: FYRLTRKVFANPEDCVAFGKGENAKKYLRTDDR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MGST1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92116.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Microsomal Glutathione S-transferase 1 Recombinant Protein Antigen

  • glutathione S-transferase 12
  • GST12EC 2.5.1.18
  • MGC14525
  • MGST
  • MGST-I
  • microsomal glutathione S-transferase 1
  • Microsomal GST-1
  • Microsomal GST-I

Background

The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16686
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-49118
Species: Hu
Applications: IHC,  IHC-P
NBP1-87852
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P
NBP1-69315
Species: Hu
Applications: WB
NBP1-82653
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NB300-891
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NBP3-17058
Species: Hu
Applications: IHC,  IHC-P
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP1-47829
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC,  IHC-P, WB
NBP1-86616
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-24722
Species: Hu
Applications: IHC,  IHC-P, In vitro, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC,  IHC-P, WB
NB110-58748
Species: Hu, Mu
Applications: ICC/IF, KD, Simple Western, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP) (0)

There are no publications for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP) (0)

There are no reviews for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Microsomal Glutathione S-transferase 1 Products

Research Areas for Microsomal Glutathione S-transferase 1 Protein (NBP1-92116PEP)

Find related products by research area.

Blogs on Microsomal Glutathione S-transferase 1

There are no specific blogs for Microsomal Glutathione S-transferase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Microsomal Glutathione S-transferase 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MGST1