MICALL2 Antibody

Images

 
Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining of human tonsil shows low expression as expected.
Immunohistochemistry: MICALL2 Antibody [NBP1-82073] - Staining of human kidney shows strong cytoplasmic and membrane positivity in cells in tubules.
Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining of human small intestine shows high expression.
Immunohistochemistry-Paraffin: MICALL2 Antibody [NBP1-82073] - Staining in human small intestine and tonsil tissues using anti-MICALL2 antibody. Corresponding MICALL2 RNA-seq data are presented for the same tissues.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MICALL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DVCDNWLRPEPPGQEARVQSWKEEEKKPHLQGKPGRPLSPANVPALPGETVTSPVRLHPDYLSPEEIQRQLQDIERRLDALELRGVELEKRL
Specificity
Specificity of human MICALL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MICALL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MICALL2 Protein (NBP1-82073PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MICALL2 Antibody

  • FLJ41996
  • FLJ44858
  • FLJ45410
  • JRAB
  • junctional Rab13-binding protein
  • MICAL-L2
  • MICAL-like 2
  • MICAL-like protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-85799
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87402
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00000081-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-04611
Species: Hu
H00004218-M02
Species: Hu, Ze
Applications: WB, ELISA, ICC/IF, IHC-P
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-03135
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00085377-B01P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-85683
Species: Hu
Applications: IHC, IHC-P
NBP2-47405
Species: Hu
Applications: IHC, IHC-P
NBP2-57496
Species: Hu
Applications: ICC/IF
NBP2-66296
Species: Hu
NBP2-47373
Species: Hu
Applications: IHC, IHC-P
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB

Publications for MICALL2 Antibody (NBP1-82073) (0)

There are no publications for MICALL2 Antibody (NBP1-82073).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICALL2 Antibody (NBP1-82073) (0)

There are no reviews for MICALL2 Antibody (NBP1-82073). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MICALL2 Antibody (NBP1-82073) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for MICALL2 Antibody (NBP1-82073)

Discover related pathways, diseases and genes to MICALL2 Antibody (NBP1-82073). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MICALL2

There are no specific blogs for MICALL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICALL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MICALL2