MICAL1 Antibody

Images

 
Western Blot: MICAL1 Antibody [NBP1-85141] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: MICAL1 Antibody [NBP1-85141] - Staining of human tonsil shows moderate cytoplasmic positivity in subsets of germinal center cells.
Immunohistochemistry: MICAL1 Antibody [NBP1-85141] - Staining of human skeletal muscle shows distinct cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MICAL1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VRDLYDVLAKEPVQRNNDKTDTGMPATGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWADGLALCALVYRLQPGLLEPSELQGLGALEATAWALKV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MICAL1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MICAL1 Protein (NBP1-85141PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MICAL1 Antibody

  • CasL interacting molecule
  • DKFZp434B1517
  • FLJ11937
  • FLJ21739
  • MICALMolecule interacting with CasL protein 1
  • microtubule associated monoxygenase, calponin and LIM domain containing 1
  • NEDD9 interacting protein with calponin homology and LIM domains
  • NEDD9-interacting protein with calponin homology and LIM domains
  • NICALMICAL-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-44192
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
H00085377-B01P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
H00011329-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-2218
Species: Hu, Mu, Rt, Bv, Ca, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-82073
Species: Hu
Applications: IHC, IHC-P
NBP2-47373
Species: Hu
Applications: IHC, IHC-P
H00006789-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, PLA
NBP2-45897
Species: Hu
Applications: WB, IHC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31551
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91991
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-56035
Species: Hu
Applications: WB, ICC/IF

Publications for MICAL1 Antibody (NBP1-85141) (0)

There are no publications for MICAL1 Antibody (NBP1-85141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MICAL1 Antibody (NBP1-85141) (0)

There are no reviews for MICAL1 Antibody (NBP1-85141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MICAL1 Antibody (NBP1-85141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MICAL1 Products

Bioinformatics Tool for MICAL1 Antibody (NBP1-85141)

Discover related pathways, diseases and genes to MICAL1 Antibody (NBP1-85141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MICAL1 Antibody (NBP1-85141)

Discover more about diseases related to MICAL1 Antibody (NBP1-85141).
 

Pathways for MICAL1 Antibody (NBP1-85141)

View related products by pathway.

PTMs for MICAL1 Antibody (NBP1-85141)

Learn more about PTMs related to MICAL1 Antibody (NBP1-85141).

Blogs on MICAL1

There are no specific blogs for MICAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MICAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MICAL1