Recombinant Human mGluR8 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human mGluR8 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 486-575 of Human mGluR8

Source: Wheat Germ

Amino Acid Sequence: KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRM8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human mGluR8 Protein

  • FLJ41058
  • glutamate metabotropic receptor 8
  • glutamate receptor, metabotropic 8
  • GPRC1H
  • GPRC1HMGLUR8GLUR8
  • GRM8
  • metabotropic glutamate receptor 8
  • MGC126724
  • mGlu8
  • mGluR8

Background

GRM8 - glutamate receptor, metabotropic 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
NBP2-61856
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67508
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-89483
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89489
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC
NBP1-80886
Species: Hu
Applications: WB, IHC, IHC-P
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90944
Species: Hu
Applications: WB, IHC, IHC-P, PAGE
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-88790
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for mGluR8 Partial Recombinant Protein (H00002918-Q01) (0)

There are no publications for mGluR8 Partial Recombinant Protein (H00002918-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR8 Partial Recombinant Protein (H00002918-Q01) (0)

There are no reviews for mGluR8 Partial Recombinant Protein (H00002918-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mGluR8 Partial Recombinant Protein (H00002918-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for mGluR8 Partial Recombinant Protein (H00002918-Q01)

Discover related pathways, diseases and genes to mGluR8 Partial Recombinant Protein (H00002918-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR8 Partial Recombinant Protein (H00002918-Q01)

Discover more about diseases related to mGluR8 Partial Recombinant Protein (H00002918-Q01).
 

Pathways for mGluR8 Partial Recombinant Protein (H00002918-Q01)

View related products by pathway.

PTMs for mGluR8 Partial Recombinant Protein (H00002918-Q01)

Learn more about PTMs related to mGluR8 Partial Recombinant Protein (H00002918-Q01).
 

Research Areas for mGluR8 Partial Recombinant Protein (H00002918-Q01)

Find related products by research area.

Blogs on mGluR8

There are no specific blogs for mGluR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human mGluR8 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM8