Recombinant Human mGluR1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human mGluR1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human GRM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GRM1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human mGluR1 Protein

  • glutamate receptor, metabotropic 1
  • GPRC1A
  • GRM1
  • GRM1A
  • metabotropic glutamate receptor 1
  • mGluR1
  • MGLUR1A
  • MGLUR1GPRC1AmGlu1

Background

The Metabotropic Glutamate Receptor mGluR1 binds L-glutamate, the major excitatory neurotransmitter in the central nervous system, which activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. mGluR1 and mGluR5 are group I receptors that have been shown to activate phospholipase C. Alternative splice variants of the mGluR1 gene have been described, but their full-length nature has not been determined. Inflammation results in the activation of mGluR1 and mGluR5 in dorsal horn neurons of the spinal cord, leading to extracellular signal-regulated kinase (ERK) activation, which is required for nociceptive plasticity and enhanced pain. mGluR1 has been reported in various regions of the brain and spinal cord. ESTs have been isolated from brain and eye libraries. Caution: GLUR1 refers to Ionotropic Glutamate Receptor 1, not to Metabotropic Glutamate Receptor 1 (mGLUR1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NB300-124
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF7387
Species: Hu
Applications: Flow, IHC, CyTOF-ready
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NLS3208
Species: Hu, Po, Bv, Eq, Mk, Pm
Applications: WB, IHC-P, ICC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-44999
Species: Hu, Mu
Applications: WB, ICC/IF
H00056899-P01
Species: Hu
NBP1-88323
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS921
Species: Hu, Bv
Applications: WB, IHC-P, ICC
AF2185
Species: Hu, Mu, Rt
Applications: WB, IP
AF2364
Species: Hu
Applications: WB, IHC
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB5277
Species: Hu
Applications: WB, IHC
NB300-189
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
NBP2-01770
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85487
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for mGluR1 Partial Recombinant Protein (H00002911-Q01) (0)

There are no publications for mGluR1 Partial Recombinant Protein (H00002911-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR1 Partial Recombinant Protein (H00002911-Q01) (0)

There are no reviews for mGluR1 Partial Recombinant Protein (H00002911-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mGluR1 Partial Recombinant Protein (H00002911-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional mGluR1 Products

Bioinformatics Tool for mGluR1 Partial Recombinant Protein (H00002911-Q01)

Discover related pathways, diseases and genes to mGluR1 Partial Recombinant Protein (H00002911-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR1 Partial Recombinant Protein (H00002911-Q01)

Discover more about diseases related to mGluR1 Partial Recombinant Protein (H00002911-Q01).
 

Pathways for mGluR1 Partial Recombinant Protein (H00002911-Q01)

View related products by pathway.

PTMs for mGluR1 Partial Recombinant Protein (H00002911-Q01)

Learn more about PTMs related to mGluR1 Partial Recombinant Protein (H00002911-Q01).
 

Research Areas for mGluR1 Partial Recombinant Protein (H00002911-Q01)

Find related products by research area.

Blogs on mGluR1

There are no specific blogs for mGluR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

mGluR6 Antibody
NB300-189

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human mGluR1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM1
Entrez