mGluR1 Antibody (1F7)

Images

 
Sandwich ELISA: mGluR1 Antibody (1F7) [H00002911-M02] - Detection limit for recombinant GST tagged GRM1 is 0.1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
1F7
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

mGluR1 Antibody (1F7) Summary

Immunogen
GRM1 (NP_000829, 387 a.a. ~ 486 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPNFKRICTGNESLEENYVQDSKMGFVINAIYAMAHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYDIMNLQY
Specificity
GRM1 (1F7)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GRM1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for mGluR1 Antibody (1F7)

  • glutamate receptor, metabotropic 1
  • GPRC1A
  • GRM1
  • GRM1A
  • metabotropic glutamate receptor 1
  • mGluR1
  • MGLUR1A
  • MGLUR1GPRC1AmGlu1

Background

The Metabotropic Glutamate Receptor mGluR1 binds L-glutamate, the major excitatory neurotransmitter in the central nervous system, which activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. mGluR1 and mGluR5 are group I receptors that have been shown to activate phospholipase C. Alternative splice variants of the mGluR1 gene have been described, but their full-length nature has not been determined. Inflammation results in the activation of mGluR1 and mGluR5 in dorsal horn neurons of the spinal cord, leading to extracellular signal-regulated kinase (ERK) activation, which is required for nociceptive plasticity and enhanced pain. mGluR1 has been reported in various regions of the brain and spinal cord. ESTs have been isolated from brain and eye libraries. Caution: GLUR1 refers to Ionotropic Glutamate Receptor 1, not to Metabotropic Glutamate Receptor 1 (mGLUR1).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-126
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NB300-124
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NLS4713
Species: Hu, Pm, Mu, Po, Pm, Rb
Applications: IHC, IHC-P, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NLS3208
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-44999
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-17099
Species: Hu
Applications: IHC, IHC-P
NBP1-88323
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NLS921
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
H00000761-M02
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
AF2364
Species: Hu
Applications: IHC, WB
NBP1-47842
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-75510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB5277
Species: Hu
Applications: IHC, WB
NB300-189
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-01770
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00009455-D01P
Species: Hu, Mu
Applications: ICC/IF, WB
H00002911-M02
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for mGluR1 Antibody (H00002911-M02) (0)

There are no publications for mGluR1 Antibody (H00002911-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for mGluR1 Antibody (H00002911-M02) (0)

There are no reviews for mGluR1 Antibody (H00002911-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for mGluR1 Antibody (H00002911-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mGluR1 Products

Bioinformatics Tool for mGluR1 Antibody (H00002911-M02)

Discover related pathways, diseases and genes to mGluR1 Antibody (H00002911-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mGluR1 Antibody (H00002911-M02)

Discover more about diseases related to mGluR1 Antibody (H00002911-M02).
 

Pathways for mGluR1 Antibody (H00002911-M02)

View related products by pathway.

PTMs for mGluR1 Antibody (H00002911-M02)

Learn more about PTMs related to mGluR1 Antibody (H00002911-M02).
 

Research Areas for mGluR1 Antibody (H00002911-M02)

Find related products by research area.

Blogs on mGluR1

There are no specific blogs for mGluR1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mGluR1 Antibody (1F7) and receive a gift card or discount.

Bioinformatics

Gene Symbol GRM1
Entrez
OMIM
Uniprot