MFSD11 Antibody

Images

 
Western Blot: MFSD11 Antibody [NBP1-93984] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MFSD11 Antibody [NBP1-93984] - Staining of human cell line A-431 shows localization to nuclear speckles.
Immunohistochemistry-Paraffin: MFSD11 Antibody [NBP1-93984] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
Western Blot: MFSD11 Antibody [NBP1-93984] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MFSD11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DSENVLGEDESSDDQDMEVNESAQNNLTKAVDAFKKSFKLCVTKEML
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MFSD11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MFSD11 Protein (NBP1-93984PEP)
Publications
Read Publication using NBP1-93984.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MFSD11 Antibody

  • ET
  • FLJ20226
  • FLJ22196
  • major facilitator superfamily domain containing 11
  • major facilitator superfamily domain-containing protein 11
  • protein ET
  • UNC93-like protein MFSD11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF009
Species: Hu
Applications: IHC, WB
NB200-541
Species: Mu
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MAB1233
Species: Hu
Applications: CyTOF-ready, Flow, ICC, IP
AF1052
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
AF245
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, IP, KD, WB
NBP1-47974
Species: Ca, Hu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87581
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-24916
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
DY262
Species: Hu
Applications: ELISA
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF6108
Species: Hu
Applications: IHC
NBP2-92507
Species: Hu, Mu, Rt
Applications: ICC/IF, WB

Publications for MFSD11 Antibody (NBP1-93984)(1)

Reviews for MFSD11 Antibody (NBP1-93984) (0)

There are no reviews for MFSD11 Antibody (NBP1-93984). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MFSD11 Antibody (NBP1-93984) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MFSD11 Products

Bioinformatics Tool for MFSD11 Antibody (NBP1-93984)

Discover related pathways, diseases and genes to MFSD11 Antibody (NBP1-93984). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MFSD11

There are no specific blogs for MFSD11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MFSD11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MFSD11