MFAP4 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: MFAP4 Antibody [NBP2-30439] - Staining of human cell line BJ shows localization to endoplasmic reticulum. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: MFAP4 Antibody [NBP2-30439] -Staining of human lung shows moderate extracellular space positivity in pneumocytes and macrophages.

Immunohistochemistry-Paraffin: MFAP4 Antibody [NBP2-30439] -Staining of human prostate shows moderate extracellular space positivity in smooth muscle cells.

Immunohistochemistry-Paraffin: MFAP4 Antibody [NBP2-30439] -Staining of human endometrium shows moderate extracellular space positivity in stromal cells.

Immunohistochemistry-Paraffin: MFAP4 Antibody [NBP2-30439] -Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MFAP4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MFAP4 Antibody - BSA Free (NBP2-30439) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-MFAP4 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SGIRGDALERFCLQQPLDCDDIYAQGYQSDGVYLIYPSGPSVPVPVFCDMTT
• Predicted Species: Mouse (92%), Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFAP4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MFAP4 Protein (NBP2-30439PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MFAP4 Antibody - BSA Free

• MFAP4
• MFAP-4
• microfibril-associated glycoprotein 4
• microfibrillar-associated protein 4

Background

MFAP4, also known as Microfibril-associated glycoprotein 4, has 2 isoforms, a 255 amino acid short isoform that is 29 kDa and a long 297 amino acid isoforms that is 33 kDa, binding specificities for both collagen and carbohydrate, and it is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The protein is being studied for its involvement in smith-magenis syndrome, intracranial aneurysm, liver cirrhosis, and ovarian cancer. MFAP4 protein involvement has been observed with relation to SFTPD and HDAC1 in molecules associated with elastic fibres, extracellular matrix organization, and elastic fibre formation pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MFAP4 Antibody (NBP2-30439)(2)

Publications using NBP2-30439

• Kurten CHL, Kulkarni A, Cillo AR et al. Investigating immune and non-immune cell interactions in head and neck tumors by single-cell RNA sequencing Nature communications 2021-12-17 [PMID: 34921143] (IHC-P, Human)
• Jin H, Goossens P, Juhasz P et al. Integrative multiomics analysis of human atherosclerosis reveals a serum response factor driven network associated with intraplaque hemorrhage Clinical and Translational Medicine 2021-06-01 [PMID: 34185408] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: MFAP4
• Uniprot:
  • P55083()