MFAP4 Antibody - BSA Free

Western Blot: MFAP4 Antibody [NBP1-59158] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Immunohistochemistry: MFAP4 Antibody [NBP1-59158] - SampleType : Mouse sciatic nerve Dilution : 1: 500 Secondary Antibody : Biotinylated Anti-Rabbit 1: 1000 followed by avidin-biotin and diaminobenzidine Secondary Antibody Dilution : 1: 1000 Gene Name : MFAP4

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MFAP4 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to MFAP4(microfibrillar-associated protein 4) The peptide sequence was selected from the N terminal of MFAP4. Peptide sequence TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MFAP4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MFAP4 Antibody - BSA Free

• MFAP4
• MFAP-4
• microfibril-associated glycoprotein 4
• microfibrillar-associated protein 4

Background

MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.This gene encodes a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene is located within the Smith-Magenis syndrome region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MFAP4
• Uniprot:
  • P55083()