MESDC2 Antibody

Images

 
Western Blot: MESDC2 Antibody [NBP1-88555] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: MESDC2 Antibody [NBP1-88555] - Staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MESDC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MESDC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MESDC2 Protein (NBP1-88555PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MESDC2 Antibody

  • BOCA
  • KIAA0081Renal carcinoma antigen NY-REN-61
  • MESDC2
  • MESDLDLR chaperone MESD
  • mesoderm development candidate 2Mesoderm development protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1886
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NBP1-33560
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52506
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-33002
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NLS6792
Species: Hu, Mu, Po, Bt, Bv, Ca, Eq, Ha, Mk, Pm, Rb
Applications: IHC-P
AF1620
Species: Mu
Applications: WB, IHC
AF1360
Species: Mu
Applications: WB, IHC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-87770
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, ICC
NBP1-88555
Species: Hu
Applications: WB, IHC, IHC-P

Publications for MESDC2 Antibody (NBP1-88555) (0)

There are no publications for MESDC2 Antibody (NBP1-88555).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MESDC2 Antibody (NBP1-88555) (0)

There are no reviews for MESDC2 Antibody (NBP1-88555). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MESDC2 Antibody (NBP1-88555) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MESDC2 Products

Bioinformatics Tool for MESDC2 Antibody (NBP1-88555)

Discover related pathways, diseases and genes to MESDC2 Antibody (NBP1-88555). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MESDC2 Antibody (NBP1-88555)

Discover more about diseases related to MESDC2 Antibody (NBP1-88555).
 

Pathways for MESDC2 Antibody (NBP1-88555)

View related products by pathway.

PTMs for MESDC2 Antibody (NBP1-88555)

Learn more about PTMs related to MESDC2 Antibody (NBP1-88555).

Blogs on MESDC2

There are no specific blogs for MESDC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MESDC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MESDC2
Entrez