MESDC2 Antibody - BSA Free

Immunohistochemistry-Paraffin: MESDC2 Antibody [NBP1-88555] - Staining of human duodenum shows moderate cytoplasmic and nuclear positivity in glandular cells.

Analysis using Anti-MESDC2 antibody NBP1-88555 (A) shows similar pattern to independent antibody NBP3-05518 (B).

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MESDC2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MESDC2 Antibody - BSA Free (NBP1-88555) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MESD
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MESDC2 Protein (NBP1-88555PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MESDC2 Antibody - BSA Free

• BOCA
• KIAA0081Renal carcinoma antigen NY-REN-61
• MESDC2
• MESDLDLR chaperone MESD
• mesoderm development candidate 2Mesoderm development protein

Background

Chaperone specifically assisting the folding of beta-propeller/EGF modules within the family of low-density lipoprotein receptors (LDLRs). Acts as a modulator of the Wnt pathway, since some LDLRs are coreceptors for the canonical Wnt pathway. Essential for specification of embryonic polarity and mesoderm induction

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MESD